KEGG   Nipponia nippon (crested ibis): 104008747
Entry
104008747         CDS       T05756                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
nni  Nipponia nippon (crested ibis)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 Mst1_SARAH
Other DBs
NCBI-GeneID: 104008747
NCBI-ProteinID: XP_009458924
LinkDB
Position
Unknown
AA seq 287 aa
MGIPASQYWAHTLGTGISLTPGIRCSHCSFTCHYRCRALVRLDCSGPPGAGDEDDGTEQA
LEKDTNVDEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVR
PVSVPATKRVPSLQAGRSGLRAQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKF
TVVDNPRKFALFERSEKDEQVYLRKLADEEQPLRLRLLAGPSEKVLSFVLKENETGEVNW
DAFTLPELHNFLRILQREEEEHVRQLRHRYARCRQKMQEALATRMPG
NT seq 864 nt   +upstreamnt  +downstreamnt
atgggcatcccagcatcccagtactgggcacacacattgggcacaggcatctcactcaca
ccaggcatcaggtgttcccactgcagcttcacctgccactaccggtgccgggccctggtg
cggctggactgcagcggccccccgggcgctggcgacgaggacgatggcaccgagcaggcg
ctggagaaggacaccaacgtggatgagcccagcgagtgggagaagacagagctggaccag
gcgcaggtggagcagcggatcaaggagtacaacagccagatcaacagcaacctcttcatg
agcctgaacaaggatggctcctacaccggcttcatcaaggtgcagctgaagctggtgcgc
cccgtctcggtgccggccaccaagcgggtcccctccctgcaggcggggcggtcagggctg
cgcgcccagggggtgaagcgccgtacgtccttctacctgcccaaggggactgtcaagcac
ctgcacatcctctcacacacgcgcgccagcgaggtcatcgacgccctcctccgcaagttc
accgtcgtcgacaacccccgcaagttcgccctcttcgagaggtccgagaaggatgagcaa
gtgtacctgcggaagctggctgatgaggagcagcccctgcggctgcggctgctggctggc
cccagcgagaaggtgctcagcttcgtcctgaaggagaatgagaccggggaggtgaactgg
gacgccttcacgctgccggagctgcacaacttcctgcgcatcctgcagcgggaggaggag
gagcacgtgcgccagctgcggcaccgctacgcccgctgccgacagaagatgcaggaggcc
ctggccacgcgcatgccggggtga

DBGET integrated database retrieval system