KEGG   Nipponia nippon (crested ibis): 104008980
Entry
104008980         CDS       T05756                                 

Gene name
PIK3CD
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104008980 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104008980 (PIK3CD)
   04370 VEGF signaling pathway
    104008980 (PIK3CD)
   04068 FoxO signaling pathway
    104008980 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    104008980 (PIK3CD)
   04150 mTOR signaling pathway
    104008980 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104008980 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    104008980 (PIK3CD)
   04218 Cellular senescence
    104008980 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104008980 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104008980 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104008980 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    104008980 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104008980 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    104008980 (PIK3CD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104008980 (PIK3CD)
  09172 Infectious disease: viral
   05164 Influenza A
    104008980 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    104008980 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104008980 (PIK3CD)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104008980 (PIK3CD)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104008980 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 104008980
NCBI-ProteinID: XP_009459206
LinkDB
Position
Unknown
AA seq 1046 aa
MPPGIYCPMEFWSKGENQNIQVDFLLPTGIYLNLSVSCNASLGTIKQVVWRHAQYEPLYH
MLSDPEAYVFTCINQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKVINSQISLL
IGKGLHEFDSVQDPEVNDFRTKMCQFCEERAAKRQQLSWAAWMEYNFPLQLEPMAKGLGT
GPLHIPTKNIFVNVKFQSGGESFTFQISPKEFPITLMSYAIKKQATVFRHETVENPEDYT
LQVNGKCEYLYGNYPLYQFQYIRSCLHRGLTPHLTMVHSSTIIAMRDEQTNCIASPPKMA
AKPPPLPKKKPNYGSLWSLEQSFYIELVQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLDFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
VNVMLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPSVAS
HPVYYPSFEQLLELGRTGEQPRAAPEDPEEKLQLKEILERRSHTELYEHEKDLVWKMRYD
IRDQYPQALAKLLIITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAI
NSLKKLTDHELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHV
PAVALRFGLILEAYCRGSTHHMKVLMKQGEALNKMKALNDFVKASSQKATKPQTKEMMHV
CMKQETYLEALSHLQSPLNPNIILAEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIF
KNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDKTGLIEVVMHSDTIANIQ
LNKSNMVATAAFNKDALLNWLKSKNPGDALEQAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRETGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRG
YCEKAYMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRLK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgcccccaggcatttactgccctatggaattctggtccaagggggaaaaccaaaacatc
caggtggactttctgctgcccacaggcatatacttaaacctgtctgtgtcctgcaatgcc
agcttgggcaccatcaagcaggtggtgtggaggcatgctcagtatgagccgctgtaccat
atgctcagtgatcccgaggcctatgtcttcacgtgcatcaaccagacagcagaacagcaa
gagctggaggatgagcaacggcggctttgtgacatccagcccttcctaccagtactgcgg
ctcgtggctcgagaaggtgacagagtcaagaaggttattaactcccagatcagcctgctc
attggaaaaggtttgcatgagttcgactctgtccaggacccagaggtgaatgatttccgc
accaaaatgtgccagttctgtgaggagagagcagcaaagcggcagcagctcagctgggca
gcttggatggagtacaactttcccttgcaactggagcccatggccaaaggccttgggact
ggccctctacatatccccaccaagaacatttttgtcaacgtcaagtttcagtctggcggg
gagagcttcactttccagatctccccaaaggagttccccatcacgttaatgagctatgct
atcaagaagcaggctactgtcttccgccatgagacggtggagaacccagaggactacacc
ctgcaggtgaatgggaaatgtgaatatctctatgggaactaccccctgtaccagttccag
tatattcgcagctgcctgcaccgaggcctaacgccccacctgaccatggtacactcctcc
actatcattgctatgagagacgagcaaaccaactgtattgccagccccccaaagatggct
gccaagcctcccccgctccctaagaaaaagccaaactatggctctctctggtccttagag
cagtctttctacattgagctggtgcaaggcagcaaggtcaatgcagatgagagaatgaag
ctggtggtgcaagcaggtctctttcatggcaatgagatgctgtgcaagacagtgtcaagc
tctgaagtgaatgtatgctcagagccagtgtggaagcagaggctggattttgatattaac
atctgtgatcttccccgtatggcgcggctctgctttgccctctacgctgtcatcgagaag
gcaaagaaggcacgttccaccaagaaaaagtccaagaaagctgactgcccaattgcctgg
gtgaatgtcatgctctttgactataaggaccagctgaaaactggggagtgctgcttgcac
atgtggtcctcctttccagatgagaaaggggaacttctgaaccccatgggcacggtacaa
tgcaaccccaacacagaaagtgcagcagccttggtcatctgcttccccagtgttgcatcg
catcctgtgtattacccgtcatttgagcagctgctggagttggggaggaccggagaacaa
ccccgcgctgcaccagaagatcctgaagagaagctgcagctgaaggagatactggagcgg
aggagccacaccgaactatatgagcatgagaaggacctggtgtggaagatgcgatacgat
atccgtgaccagtacccacaagcattggcaaagctgcttatcatcaccaaatggaacaag
catgaagacgtcgcccagatgatttccctacttcagacctggccagagttgcctgtcctg
aatgccttggagctgctggattttagctttcctgaccgttacgttggttcctttgctatc
aactcattaaagaagctgacagatcatgaattgttccaatacctgctacagcttgtccag
gtgcttaagtatgaatcctacttagactgtgaattaaccaagttcctgctggacagggcg
ttatccaaccgcaagatcggccacttcctcttctggcatctgaggtcagaaatgcacgtc
cctgcagttgccttgaggtttggcctgatcctggaagcatactgcagaggcagcacccac
catatgaaagttttgatgaaacagggagaagcactcaacaagatgaaagctctgaatgac
tttgttaaagcaagttctcagaaggccaccaagcctcaaaccaaggagatgatgcatgtg
tgcatgaagcaggaaacttacctcgaagcactttcccacctccagtcccccctgaacccc
aacattattcttgctgaagtctgtgtggatcagtgcacctttatggactccaaaatgaaa
cctttatggattgtgtttaataatgaagagacaggcggagggggagtgggtattattttt
aaaaatggagatgatcttcgtcaggacatgctgactctgcagatgatccagttgatggac
atcctgtggaagcaggagggcctggacctgaggatgaccccttatggctgcctctccaca
ggagacaagactggactgatagaagtagtcatgcattcagataccattgccaacatccag
ctcaacaagagcaacatggtggccactgcggccttcaacaaggatgcactgctgaactgg
ctaaaatccaagaacccgggtgacgcattagaacaagctatagaggagttcactctttcc
tgtgctggatactgcgtggcaacatacgtgctggggataggtgaccggcacagtgataac
atcatgatccgggaaactggacagctgttccatattgattttggtcactttttggggaac
ttcaagactaaatttggtattaatagagagcgagttcctttcatcttaacctatgacttc
gtgcatgtcatccagcaaggaaaaactaacaacaatgagaagtttgaaagattcaggggt
tattgcgaaaaagcctatatgattctgaggcgccatggtcttctcttcctgcacttgttt
gcactgatgaaagctgctggcctgccagaactcagctgctcgaaagacattcagtatcta
aaggattccctggctcttgggaaaacagatgaggaggcactgaagcacttcagactgaag
tttaatgaagccctgcgagagagctggaaaaccaaagtgaactggctggcacacaatgta
tccaaagataacagacagtag

KEGG   Nipponia nippon (crested ibis): 104015409
Entry
104015409         CDS       T05756                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104015409 (PIK3R3)
   04370 VEGF signaling pathway
    104015409 (PIK3R3)
   04068 FoxO signaling pathway
    104015409 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    104015409 (PIK3R3)
   04150 mTOR signaling pathway
    104015409 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104015409 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    104015409 (PIK3R3)
   04218 Cellular senescence
    104015409 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104015409 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104015409 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104015409 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    104015409 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104015409 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    104015409 (PIK3R3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104015409 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    104015409 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104015409 (PIK3R3)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104015409 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF5638
Other DBs
NCBI-GeneID: 104015409
NCBI-ProteinID: XP_009466423
LinkDB
Position
Unknown
AA seq 463 aa
MYNTVWDMDRDDTDWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPVNTNGIKDNSSFS
LQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRD
GKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGK
KLQEYHAQYQEKSKEYDKLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHSQERYSKE
YIERFRREGNDKEIERIMMNYEKLKSRLGEIHDSKMRLEQDLKKQALDNRETDKKMNSIK
PDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNENIDDAYFVNEEDENLPHHDEKTWF
VGDLNRIQAEDLLCGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTPRGYGFAEPY
NLYSTLKDLVLHYQQTSLVQHNDSLNVRLAYPVYAQMPPSLCR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtacaacacggtgtgggatatggaccgcgatgacacggactggagggaagtgatgatg
ccctattccactgagctgatattttacattgaaatggaccctccagctcttcctccaaag
ccccccaaaccaatgactccagtcaatacgaacggaataaaggacaactccagtttctct
ctgcaggaagcggagtggtactggggggacatctcaagggaagaagtaaatgacaaatta
cgagacatgccagatggaacattcctggtgcgcgatgcgtcaaccaagatgcagggagac
tacactctgacattacggaagggtggcaacaataaactgataaagatctatcatcgggat
ggaaaatatggcttttctgatccactgacatttaattcagttgtggaactgattaaccac
taccgcaatgagtctcttgctcagtataacccgaagcttgatgtgaagttgatgtatcca
gtgtcccggtaccagcaggatcagttggtgaaagaagataatatagatgcagtaggtaaa
aagcttcaagaataccatgctcagtatcaggaaaagagtaaagagtacgacaaattgtat
gaagaatataccagaacatcacaggaaattcagatgaagaggaccgcaattgaagcattt
aatgaaactattaagatatttgaggaacagtgccactcacaagagcgatacagcaaagaa
tacattgagcgatttcgcagggaggggaacgacaaagaaattgaacggataatgatgaac
tatgaaaaattaaaatcacgcctgggtgagatccatgatagtaaaatgcgcctggaacaa
gatttgaagaaacaagctctggacaacagggagactgataagaaaatgaatagtatcaag
cctgacctaattcagctccgcaaaatcagagatcagtatcttgtatggctcaatcacaaa
ggggtgagacagaagcgaataaatgactggctggggatcaaaaatgaaaatattgatgac
gcgtactttgtgaatgaagaagatgaaaacctgccacatcatgatgagaaaacttggttt
gttggggatctcaaccgtatccaagcagaagacttgctctgtgggaaacctgatggagca
tttttaattcgagagagtagcaagaaaggatgttatgcttgttctgtggtagctgacgga
gaagtgaaacactgtgtgatctacagcactccaagaggttacgggtttgcagaaccgtat
aacctgtacagcacacttaaggatttggttcttcattaccagcagacatcccttgtccaa
cacaacgattccctaaatgtcaggcttgcctatcctgtctacgcacagatgcccccctct
ctctgcagataa

KEGG   Nipponia nippon (crested ibis): 104018715
Entry
104018715         CDS       T05756                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104018715 (PIK3R2)
   04370 VEGF signaling pathway
    104018715 (PIK3R2)
   04068 FoxO signaling pathway
    104018715 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    104018715 (PIK3R2)
   04150 mTOR signaling pathway
    104018715 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104018715 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    104018715 (PIK3R2)
   04218 Cellular senescence
    104018715 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104018715 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104018715 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104018715 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    104018715 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104018715 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    104018715 (PIK3R2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104018715 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    104018715 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104018715 (PIK3R2)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104018715 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e
Other DBs
NCBI-GeneID: 104018715
NCBI-ProteinID: XP_009470152
LinkDB
Position
Unknown
AA seq 727 aa
MGSTDGFQYRALYPYRKEREEDIDLLPGDILVVSKGALQALGFKDGDEQTPNQIGWILGV
NERTKQKGDFPGTYVEYVGPVKISVPSHRPRVQRPLPATPGASGCRLQEALEQGSPLPDL
QEQFSPPEIAPPLLVKLVEAIEKKGLDSEMLYRTSGSELRQALRTDWTLGDLEPFDVHSL
GEALRGYLQDLPSPVVPVSVHGDILRVLQEIPQPENCRKQLLLALESPAVPLQNTLTLQF
LLRHLGKVSQQAESNSLHPRALGEIFGPLLLRLPGASPELSPDFSVLFLEILLQTKELEP
EQLPPALPPKPPKPKPSAASLANGNSVPLQDAEWYWGDISREEVNEKLRDTPDGTFLVRD
ASSKIQGEYTLTLRKGGNNKLIKIFHREGKYGFSEPLTFGSVVELITHYRHESLAQYNAK
LDTRLLYPISKYQQDQVVKEDSVEAVGEQLKVYHQQYQDKSWEYDLLYEEYTRTSQELQM
KRTAIEAFNETIKIFEEQCQTQEKCSKEYIERFRREGNEKEVQRILMNSEKLKSRITEIH
DSKMKLEQDLKKQASENREIDKRMNSLKPDLMQLRKLRDQYLVWLTQKGARQKKINEWLG
IKNETEDQYSMMDDEEELPHHEERTWYVGKINRLQAEEMLCGKRDGTFLIRESSQKGCYA
CSVVVDGDTKHCVIYKTATGYGFAEPYNLYASLKDLVLHYKHTSLVQHNDSLNVTLAHPV
LSQPPAR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgggcagcaccgatgggttccagtaccgcgcgctctacccctaccgcaaggagcgcgag
gaggacattgatctgctgcctggggacatcctggtggtgagcaagggggccctgcaagcc
ttgggcttcaaagacggggatgagcagacccccaatcagattgggtggatcctgggcgtc
aacgagcggaccaagcagaagggcgactttcccggcacgtacgtggagtacgtggggcct
gtgaagatctctgtcccttcgcaccggccccgagtgcagagacccctgcccgcgacaccg
ggggccagcggctgccggctgcaggaggctctggagcaagggtctcctctcccagacttg
caggagcagttcagccctccggagattgcaccgccgctgctggtgaagctggtggaagct
attgagaagaaagggttagacagcgagatgttgtacaggacatctggctccgaactgagg
caagcgctgagaaccgattggaccctgggcgacctggagcccttcgacgtgcactccctg
ggtgaggcgctgcgaggctacctgcaggacctgccctcccctgtggtgccggtgtccgtg
cacggagacatccttcgcgtcctgcaggagatccctcagccggagaattgccggaagcag
ctactgctggccctggagtcgcctgcggtcccgctccagaacacgctcaccctgcagttc
ctgctccggcatctggggaaggtatcgcagcaggccgagagcaacagcctccaccctcgg
gccctgggagagatcttcggcccccttctcctccggctgcctggcgccagcccagagctg
agccctgacttctccgtgctgtttctggagatacttctgcagacgaaggagttggagccg
gagcagttgcctccagccttgcctccaaaaccacctaagccaaagcccagtgcagccagc
ttggccaacgggaacagcgtgcccttgcaggacgccgagtggtactggggtgacatttct
cgggaggaggtgaacgagaagctacgggacacaccagatggtaccttcttggtgcgcgat
gcctccagcaagatccaaggggaatacacgctcacgctcagaaagggaggcaataacaag
ctgatcaagatctttcaccgagaggggaagtacggcttctcagagcctctgactttcggc
tcggtggtggagctcatcacccattaccggcacgagtcgctcgcccagtacaacgccaag
ctggacaccaggctgctctaccccatctccaaataccagcaggaccaagtggtgaaagag
gacagcgtagaagctgtcggggagcagctgaaggtctatcaccagcagtaccaggacaag
agctgggagtacgacctgctgtatgaggagtacacacgcacttcccaggagctgcagatg
aagaggacggcaatcgaggccttcaacgagacaatcaagatctttgaggagcagtgtcag
acgcaggagaaatgcagcaaggagtacatcgagcgcttccggcgggagggcaatgagaag
gaggtgcaacggatcctcatgaattcggagaagctcaagtctcgcatcacggagatccac
gacagcaagatgaagctggagcaggacctgaagaaacaagcctcggagaaccgggagatc
gacaagcgcatgaacagcctcaagccagacctcatgcagctgcgcaaactgcgggaccag
tatttggtgtggctgacacagaagggtgcccggcagaagaaaatcaacgagtggttgggc
atcaagaacgagacggaggaccagtactccatgatggatgacgaggaggagctgccgcac
cacgaggagcggacgtggtacgtggggaagatcaaccgcttgcaggcagaagagatgctg
tgcggcaagcgggacggcaccttcctgatccgtgagagcagccagaagggatgctacgcc
tgctccgtggtggtggacggtgacaccaagcactgcgtgatctacaaaacggcaaccggc
tacgggttcgctgaaccctacaacctctacgcctccctcaaagacctggtcttgcactac
aagcacacgtccctggtgcagcacaatgactccctgaatgtcacgctggctcacccggtc
ctttcccagccaccggccagatga

KEGG   Nipponia nippon (crested ibis): 104019595
Entry
104019595         CDS       T05756                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104019595 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104019595 (PIK3CA)
   04370 VEGF signaling pathway
    104019595 (PIK3CA)
   04068 FoxO signaling pathway
    104019595 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    104019595 (PIK3CA)
   04150 mTOR signaling pathway
    104019595 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104019595 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    104019595 (PIK3CA)
   04218 Cellular senescence
    104019595 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104019595 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104019595 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104019595 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    104019595 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104019595 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    104019595 (PIK3CA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104019595 (PIK3CA)
  09172 Infectious disease: viral
   05164 Influenza A
    104019595 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    104019595 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104019595 (PIK3CA)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104019595 (PIK3CA)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104019595 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15 DUF5314
Other DBs
NCBI-GeneID: 104019595
NCBI-ProteinID: XP_009471148
UniProt: A0A091VS60
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLYQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDANAPHSRALYVCPPNVESSSELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEATAKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMTVIEEHANWTISRELGFNYSYAGLSNRIARDNELRESDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSVMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccgtcatctggcgaactatggggcatccacttgatgccaccgaggatc
cttgtggagtgtcttctcccaaatggaatgatagtgactctagaatgcctccgtgaggcc
accttactaactattaaacatgaactctttaaagaagcgagaaaataccctctctatcag
ctccttcaagatgagtcttcttacatttttgtaagtgttacacaagaagcagaaagagaa
gaattttttgatgaaacacggagactttgtgacctgcgactatttcagccttttctaaaa
gtcattgaaccagtaggtaacagagaagaaaagattcttaatagagaaataggttttgct
attggcatgcctgtctgtgaatttgacatggttaaggatccagaagtacaagacttcaga
aggaatattcttaatgtttgtaaagaagcagtggatcttcgagatgccaatgcaccacat
agtagagcattatatgtctgtcctccaaatgtagaatcttcatctgagctgcccaaacac
atatacaataaactagataaagggcaaatcatagtggtgatatgggtaatagtctcacca
aacaacgataagcagaaatacaccttaaaaatcaatcatgactgcgtgcctgagcaagtt
attgctgaagccattaggaagaaaacgcgaagtatgttgctgtcatccgaacaactgaaa
ctttgcgtcttggagtaccagggcaaatatattttaaaagtgtgtggctgtgatgaatac
ttgctagaaaaatatccgctgagccagtataagtatataagaagctgtataatgcttggt
cgcatgcccaatctgatgctgatggctaaggaaagcctatacacccagctgccgctggac
acctttacgatgccgtcttattccaggcgtatctctacagctacaccctacatgaatgga
gaagctacagccaaatccctctggactataaatagtgctctcagaataagaattctctgt
gcaacctatgtaaatgtgaacattagagacatagacaagatctatgttagaacaggtatc
taccatggaggagaacctttgtgtgacaatgtgaatactcaaagggtaccttgttctaat
cccagatggaatgaatggctattgtatgacatgtacattcctgatcttccacgtgctgct
cggctctgcctttcgatctgttctgttaaaggccggaagggtgctaaagaggagcactgt
ccgttggcttggggaaatataaacatgtttgattacacagacactcttgtatctgggaaa
atggctttgaatctttgggcagtacctcatgggctggaggatttgttgaatcctattggt
gttactggatcaaatccgaataaggaaactccatgtttagagctggaatttgattggttt
agcaaccctgtaaagtttccagatatgacggtgatcgaagaacatgccaattggactata
tcacgtgaactggggtttaactacagctatgcggggctgagtaacagaatagctagagat
aacgaattaagagaaagtgacaaggagcagctgcgagccatatgtacgagagatcctttg
tctgaaatcactgagcaagagaaggacttcctctggagccacagacactactgcgtgaat
actccagaaattctgcccaaattacttctgtctgttaaatggaattctagagatgaagtg
gcccagatgtactgtttggtaaaagattggcctccaatcaagccagagcaagcgatggaa
ctattggactgtaattacccagatccaatggtgcgagcttttgcagttcggtgtctagag
aagtacttgacagatgacaaactgtctcagtacttaatccagctagtacaggttctgaaa
tatgaacagtatttagataatcagcttgtgagatttttactcaagaaagcactgaccaat
caaagaataggacacttcttcttttggcatttaaagtctgaaatgcacaataaaactgta
agtcagaggtttggtttacttctggagtcctattgtcgagcgtgtggaatgtacctaaag
catctgagcaggcaggtggaggctatggagaagttgattaacctcacagatattctcaag
caggaaaaaaaagatgagacccagaaggtacagatgaagtttcttgttgaacaaatgagg
cggccagattttatggatgctttacaaggtttcatctctcctcttaatcctgcgcatcaa
ctgggaaatcttcggcttgaggagtgcaggataatgtcatctgcaaaaaggcccctgtgg
ttgaattgggaaaacccagatattatgtctgaattgttatttcagaacaatgagataatc
tttaaaaatggagacgacttgcgtcaggacatgctgacacttcagataattagaattatg
gaaaacatctggcaaaatcagggtcttgatcttcggatgttgccttatggttgtttgtct
attggtgactgcgtcggactcatcgaggtagtgaggagctctcatacgatcatgcagatt
cagtgtaaaggaggcttgaaaggagcactgcagttcaacagccatacactgcatcagtgg
ctcaaggacaagaacaaaggagaaatgtacgatgcagctattgacttgtttacacgttcc
tgtgctggctactgcgttgctacctttatactgggcattggtgatcgccacaatagtaac
atcatggtaaaagatgacggacaactgtttcacattgactttgggcacttcctcgatcac
aagaagaaaaaatttggctataaaagagagcgtgtgccatttgtcttaacacaagacttt
ttaatagtgattagtaaaggagcccaagaatgtaccaaaacaagggagtttgaaaggttt
caggagatgtgttataaggcttacctagcaattcggcagcatgccaacctcttcataaat
cttttttccatgatgcttggctcagtaatgccagaactgcagtcctttgatgatattgca
tacattcgaaagacccttgcattggacaaaaccgagcaggaagctcttgagtacttcatg
aagcaaatgaatgatgctcaccatggtggctggacaacaaaaatggactggatcttccac
acaataaagcaacatgctttgaactga

KEGG   Nipponia nippon (crested ibis): 104023668
Entry
104023668         CDS       T05756                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00562  Inositol phosphate metabolism
nni01100  Metabolic pathways
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104023668 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104023668 (PIK3CB)
   04370 VEGF signaling pathway
    104023668 (PIK3CB)
   04068 FoxO signaling pathway
    104023668 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    104023668 (PIK3CB)
   04150 mTOR signaling pathway
    104023668 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104023668 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    104023668 (PIK3CB)
   04218 Cellular senescence
    104023668 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104023668 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104023668 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104023668 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    104023668 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104023668 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    104023668 (PIK3CB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104023668 (PIK3CB)
  09172 Infectious disease: viral
   05164 Influenza A
    104023668 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    104023668 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104023668 (PIK3CB)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     104023668 (PIK3CB)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104023668 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 104023668
NCBI-ProteinID: XP_009475789
LinkDB
Position
Unknown
AA seq 1066 aa
MPPAVTDSLDIWAVDSQIGADGSISVDFLLPTGIYINLDVPRDATISHIKQLLWKQAHAY
PLFHLLMEIDSYMFSCVNQTAVHEELEDETRRLCDVRPFLPVLKLVTRNCDPGEKLDSKI
GVLIGKGLHEFDALQDPEVNDFRAKMRRISEEKIQSLVGLSWMDWLKHTYPPEQEPVIPE
SFQDKLYSGNLVVAVHFDNCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDEEVDPAD
YVLQVSGRLEYVFGDHPLIQFQYIRNCVMNRTLPQLTLVECCTIKKMCEQEMIAIEAAIN
RKSSNLPLPLPPKKTRTTTSVWDISNPFKIILLKGNKLNTEENAKVHVRAGLFHGTELLC
KTIVSTEISGRSDHVWNEVLEFEINVCDLPRMARLCFAVYAVMDKMKTKKSTKAMNPSKY
QTIRKAGKVHYPVAWVNTMVFDYKGQLKSGELVLHSWSSFPDELEEMLNPMGTVQTNPYT
ENATALHIRFQEYSKQPINYPPFDKILEKAAEIARNSDNAAMAGRGGKKFYIVLKEIMER
DPLSQLCENEMDLIWTLRYDCRENFPQSLPKLLLSLKWNKLEDVAQLQALLQIWPKLLPR
EALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERA
LANRRIGQMLFWHLRSEVHIPAVSVQFGLILEAYCRGSVAHMKVLAKQVEALNKMKTLNS
LIKLNAMKQSKAKGKDAMHTCLKQNAYREALSDLQSPLNPSVILSELHVEKCRYMDSKMK
PLWIVYNNKMFGGDLVGIIFKNGDDLRQDMLTLQILRLMDILWKEAGLDLRILPYGCLAT
GDHSGLIEAVSSSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNLGDDLDRAIEEFTLS
CAGYCVATYVLGIGDRHSDNIMVRKNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDF
IHVIQQGKTGNTEKFGRFRQYCEEAYLILRKHGNLFITLFALMLTAGLPELTSVKDIQYL
KDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgcctcctgccgtgaccgacagccttgacatctgggcagtggattcacagattggtgct
gatggctcaatatctgtggacttcctgttgcccactggaatctacatcaacctggatgtc
cctcgagatgccaccatatctcatattaaacagctgttatggaagcaggcacatgcctat
ccactctttcatctcctcatggagattgactcttacatgttctcatgtgtgaatcagact
gctgtacatgaagaattagaggatgaaacacggagactttgtgatgttagaccctttctt
cctgtccttaaactagtgacaaggaattgtgatccaggagaaaagttggattccaaaata
ggtgtccttataggcaaaggtctccatgagttcgatgccttacaagatcctgaagtgaat
gatttccgagctaagatgcggagaatcagtgaggaaaagattcagtcgcttgtgggtctc
tcctggatggactggttaaagcacacttacccaccagaacaggaacctgttatcccagag
agcttccaagataagctctatagtggaaatcttgtagtggctgttcattttgataactgc
caggatgtatttagttttcaggtgtctcctaacatgaatcccatcaagctgaatgagctg
gcaatccgaaaacgtttgactatccatggaaaagaagatgaggaagttgatcctgctgac
tacgtgctgcaagttagtggaaggctagaatatgtttttggtgatcacccattaattcag
tttcagtatatacgcaactgtgtgatgaacaggactcttcctcagctgactctagttgag
tgttgcaccataaagaagatgtgtgagcaggagatgattgccatagaagctgccataaac
cgaaaatcatccaaccttcctcttcctctgccaccaaaaaaaacaagaacaacaaccagt
gtatgggatatttccaaccctttcaagattattctgttaaagggtaataaactaaataca
gaagaaaatgccaaagttcatgttagagccggtcttttccatggtacagagctcctttgt
aaaactattgtaagcacagaaatatctgggagaagtgaccatgtttggaacgaagtacta
gagtttgaaataaatgtctgtgacttaccaagaatggcaaggctctgctttgcagtttat
gctgtgatggataagatgaaaactaaaaagtcaaccaaggcaatgaatccttccaaatac
caaaccattaggaaagcaggaaaagtgcattatcctgtagcctgggtaaataccatggta
tttgactataaaggacagctgaagagtggagaactggtactgcacagctggtcatcattt
cctgatgaacttgaagaaatgttgaatccaatgggaaccgtccagactaacccttacact
gaaaatgcaacagctctgcacattagatttcaagaatattcaaaacagcctattaattac
cctccctttgataagatacttgaaaaggcagctgagattgcaagaaacagtgacaatgct
gcaatggcgggtcgaggtggtaagaagttttatattgtgctaaaagaaataatggaaaga
gatcctttatctcaactctgtgaaaatgaaatggatcttatttggactttgcgatatgac
tgtcgtgaaaatttcccacaatcattgccaaaactgctgctctctttaaaatggaacaaa
cttgaagatgttgctcagcttcaggctctccttcagatatggcccaagctgctgcctaga
gaagcattagaattgttggatttcaattatccagaccagtacgtcagagaatatgcagtg
ggttgtttaaagcaaatgagtgatgaagagctctctcaatatcttcttcaacttgtgcaa
gtcctgaaatacgaaccttttcttgattgtgcgctctccagatttctgttagagagagcg
cttgctaataggagaataggacagatgttgttttggcatctaaggtcagaggttcacata
cctgccgtttcagtacagtttggtttgatacttgaagcttactgccgaggaagtgttgct
catatgaaagtgcttgctaaacaggtggaagcccttaataaaatgaagactttaaatagt
ctaattaagctgaatgccatgaagcaaagcaaagcaaaaggaaaagatgcaatgcataca
tgtttgaaacaaaatgcttacagagaagcactttccgacctccagtctcctctgaatcct
tctgttatactttcagaactacatgttgagaagtgtagatatatggattctaaaatgaag
cctctatggatagtatacaacaataaaatgtttggaggagatcttgtagggatcatcttt
aaaaatggtgatgatctccgacaggacatgttgacgctccagattttgcgtttgatggac
atactttggaaagaagctggtctggatctccggatattgccatatggctgtttagcaact
ggagatcactccggccttattgaggctgtttctagttcagaaaccattgctgacattcag
ttaaatagtagcaatgttgctgctgctgctgccttcaacaaagatgctctcttaaactgg
ctgaaggaatacaacttaggagatgacttggatcgagccattgaagaatttactctgtct
tgtgctggctactgtgtagctacttacgtattagggattggtgacagacacagtgacaat
atcatggtcagaaaaaacggtcagctctttcatatagattttgggcatattcttggaaac
ttcaagtccaaatttggaattaaaagggaacgagtacctttcatactcacctatgacttc
attcatgttattcaacaaggaaaaacagggaacactgaaaaatttggtcggttccgccag
tattgtgaagaagcctacttgattctgcgaaaacacggaaacctatttattacactcttt
gcactgatgttaactgcagggcttccagagctaacctctgtcaaggacatccagtatctc
aaggactctctcgccttagggaagagtgaggaagaagcactaaaacaatttaagcaaaag
tttgatgaagcactccgggaaagctggactactaaagtgaactggatggctcacactgtt
cgaaaagactacagatcctag

DBGET integrated database retrieval system