KEGG   Nipponia nippon (crested ibis): 104009114
Entry
104009114         CDS       T05756                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04114  Oocyte meiosis
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104009114 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104009114 (CCNB1)
   04114 Oocyte meiosis
    104009114 (CCNB1)
   04115 p53 signaling pathway
    104009114 (CCNB1)
   04218 Cellular senescence
    104009114 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104009114 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nni03032]
    104009114 (CCNB1)
   03036 Chromosome and associated proteins [BR:nni03036]
    104009114 (CCNB1)
DNA replication proteins [BR:nni03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104009114 (CCNB1)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104009114 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104009114
NCBI-ProteinID: XP_009459341
LinkDB
Position
Unknown
AA seq 342 aa
MTVAAKISSHPDTSQASANLHADRHRQLSLEPQSPTPMETSGCTPSDDNLCQAFSDVLLD
VEDVDVDDGTDPNLCSNYVKDIYKYLKDLEENQPVRPTYLAGQEINGSMRAILIDWLVQV
QVKFRLQQETLYMAVAIIDRFLQDNGVSKKTLQLVGVTAMFIASKYEEVFPPHIGDFVYV
TDNTYTKLQISQMEMKILQALNFCLGRPLPPHFLRRASKIAEVDLEQHVLAKYLMELSIV
DYDMVHFPPSKTAAAASCLALKLLNGCEWTPTLQHYMSYTESDLLPVMQHIAKNVILVNE
GITKQTAIKNKYSSSKHAKISAIKQLDSSIVWNLAQPLIKKS
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaccgtggcagcgaagatcagctcgcacccggatacttcacaggcgagtgcaaacctg
cacgctgacaggcatcggcagctttctttggagcctcagtctcccacccccatggagaca
tctggatgcaccccatcagacgacaacctgtgccaagctttttctgatgtcttgctcgat
gtggaagatgtcgatgtggatgatggcactgacccaaacctctgcagcaactatgtgaag
gacatctacaagtatctgaaagaccttgaggaaaaccaacctgtcagacccacatacctg
gctggccaggaaatcaatgggagcatgcgtgccatactaatagactggcttgtgcaagta
caggtaaaattcagactccagcaggagaccttgtacatggcagttgctatcatcgatcgc
ttcctgcaggacaatggtgtttccaagaagacattgcagctggttggtgtcacagctatg
ttcattgccagcaaatacgaagaagtgtttcctccacatattggagattttgtctatgta
acggataacacttacacaaagctccaaatctcccagatggagatgaagatcctgcaagcc
ctgaacttttgtctgggtcgccctctccctccgcacttcctaaggagggcttcaaagata
gcagaggtggacttggagcagcatgttctagccaagtacctgatggagctgtccattgtg
gactatgatatggttcacttccctccatccaagactgcggcggctgcttcctgtttggct
ctgaaactcctcaatggatgtgagtggacaccaactctgcaacactacatgtcttacact
gagagtgaccttctcccagttatgcagcatatagcaaagaatgtaattcttgtgaatgag
ggcattaccaagcagacggcaatcaagaacaaatactccagcagcaaacatgccaagata
agtgccattaaacaactggactcttctattgtatggaatctagcccaacctctaattaaa
aagtcttaa

KEGG   Nipponia nippon (crested ibis): 104012632
Entry
104012632         CDS       T05756                                 

Gene name
CCNB3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04218  Cellular senescence
nni04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104012632 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104012632 (CCNB3)
   04218 Cellular senescence
    104012632 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104012632 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nni03032]
    104012632 (CCNB3)
   03036 Chromosome and associated proteins [BR:nni03036]
    104012632 (CCNB3)
DNA replication proteins [BR:nni03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104012632 (CCNB3)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104012632 (CCNB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104012632
NCBI-ProteinID: XP_009463290
LinkDB
Position
Unknown
AA seq 405 aa
MPLPRNAKMLSTKQPRAGKVGPAVENANPEKEESCQAKRSPSSPQGGPKKRSAFGDITNA
HKNQVVAGKKEAVKVAPHKAQRTHAALGVAKNNEINLKKSMKKTPPTEAPAEPKKDPVPE
EPVPAQVPAVEDIDKEQLDDPYANAQYAKEIFEYMRGREEKFMLPDYMEKQPDISGDMRA
ILVDWMVEVQENFELNHETLYLAVKLVDHYLVEVVSMRDKLQLIGSTAILIASKFEERCP
PCVDDFLYICDDAYKREELIAMEMSILSTLKFDINIPIPYRFLRRFAKCARATMETLTLA
RFLCEMTLQEYDYARESPSKLAASCLLLALTMKNLGGWTPTLEYYSGYRSQDLHPLVKRL
NFLLTYQPHDKLKAVRTKYSHRVFFEVAKVTPMDMLKLEEILKSC
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgccgttgccacgcaatgccaagatgctgagcaccaagcagccccgagcaggcaaggtg
ggtcctgctgtggagaatgccaaccctgagaaggaggagagctgtcaggccaagaggtct
ccatcctcaccccagggcgggcccaagaagaggtcggcattcggggatatcactaatgct
cacaagaaccaggtggtggcagggaagaaggaggctgtgaaagtggcaccacacaaggca
cagaggacccatgctgccctgggggtggccaagaacaatgagatcaacctgaaaaagtca
atgaagaaaactcccccgacagaagctcctgcagagcccaagaaggatcctgtgccagag
gagccggtgcctgcgcaggtaccagctgtggaggacatagacaaggagcagttggatgac
ccctacgccaatgcacagtatgccaaggagatctttgaatacatgcggggaagagaggag
aaattcatgctccctgactacatggaaaagcagccagacatcagtggggacatgcgtgcc
atcctggtggactggatggtggaggtgcaggagaactttgagctgaaccacgagacgctg
tacctggctgtgaagctggtggaccactacctggtggaggtggtgagcatgagggacaag
ctgcagctcatcggctccactgccatcctcatcgcctccaaatttgaggagcgctgccca
ccgtgcgtggatgacttcctctacatctgtgacgatgcctacaagcgggaagagctcatt
gctatggagatgagcatcctcagcaccctcaagttcgacatcaacatccccatcccctac
cggttcctgcgacgctttgccaagtgcgcccgtgccaccatggagacgctgacgctggcc
cgcttcctctgcgagatgaccctgcaggagtatgattatgcccgggagagcccctccaag
ctggctgccagctgcctgctgctggcactcaccatgaagaaccttggtggctggaccccc
acgctggagtactacagcgggtaccgctcccaggacctgcatccgctggtgaagaggctg
aatttcctgctcacgtaccagccccacgacaagctgaaggctgtgcgcaccaagtactca
cacagggtcttctttgaggttgccaaagtcacccctatggacatgctcaagctggaggag
atactgaagagctgctag

KEGG   Nipponia nippon (crested ibis): 104016845
Entry
104016845         CDS       T05756                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04114  Oocyte meiosis
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104016845 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104016845 (CCNB2)
   04114 Oocyte meiosis
    104016845 (CCNB2)
   04115 p53 signaling pathway
    104016845 (CCNB2)
   04218 Cellular senescence
    104016845 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104016845 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nni03032]
    104016845 (CCNB2)
   03036 Chromosome and associated proteins [BR:nni03036]
    104016845 (CCNB2)
DNA replication proteins [BR:nni03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104016845 (CCNB2)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104016845 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104016845
NCBI-ProteinID: XP_009468057
LinkDB
Position
Unknown
AA seq 416 aa
MGEWVGNKNCLSNGWHAQTYTGTVVVTRGVENAVTEKSRAKTHLTVKRGALEEIGNKVAT
RGTRIAKKTEYSKAPIKPTKGPSKMTNVTVLPKPPAAVNRSLKETGVPKVLSPVPMDVSV
QEKDLCQAFSDVLLNNVEDIDAEDWGNPQLCSDYVKDIYLYLRELELQQSVRPHYLDGKT
INGRMRAILVDWLVQVHSRFALLQETLYMCVALIDRFLQSRLVPRRSLQLVGVAALFLAS
KYEEMHSPDVADFVYITDNAYTDNEVREMEIMILKELDFNLGRPLPIHFLRRASKAGEAD
GKEHTLAKYLMELTLIDYDMVHHRPSEIAAAALCLSQKVLGTNKWGTKQQYYTGYTEDNL
VVAMKHMAKNVVKVNEKLTKYTAIKSKYASNRLLMVSTIPQLNGKIIKDLASSLLG
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggtgaatgggtaggaaataaaaactgcttgagtaatggatggcatgcacagacgtac
accggtacagtggtggtcactagaggggtggagaatgctgtgactgaaaaaagtagagcc
aaaactcaccttactgtcaaaaggggtgctttggaagaaataggaaataaagttgcaaca
agaggaacacgtatagctaagaaaacagaatactccaaagcacctataaagcctacgaaa
ggacctagtaagatgacaaatgtaactgtactgcctaaacctccagctgctgtgaatcga
tcactcaaagaaactggtgttccaaaggttctgtctcctgtccctatggatgtgtctgtg
caagaaaaggatttgtgccaagccttctctgatgtgttgctcaacaacgtagaagacatt
gatgctgaggactgggggaatccccagctgtgtagtgactatgtaaaagatatctatctg
tatctcagagagctcgagctgcagcaatcggtccgcccacattacctggacgggaagacg
atcaatgggcgtatgcgtgcaattttagttgactggcttgtccaggtccactcaagattc
gcgcttttgcaggaaacactgtatatgtgtgttgcacttattgatcgcttcttacaaagt
cggctagtacctcgtaggagccttcagctggtgggtgtagcagcattgtttctagcttca
aaatatgaagagatgcactctcctgatgtagcagactttgtttacattactgacaatgcc
tacactgataatgaagttagagaaatggagattatgattcttaaagagttagacttcaat
ttgggacgacctcttccaattcacttcttaagaagagcatcaaaagctggggaggctgac
ggtaaggaacacacgctagcaaaatacctaatggagctgacgctgatagactacgacatg
gttcaccatcgtccttcagagattgcagctgctgcattatgcttgtcccaaaaggttctg
ggaactaacaaatggggtacaaagcagcagtactacactgggtatacagaagacaatctt
gtggtggctatgaaacatatggccaagaacgtggtcaaagtaaatgagaagttaacaaaa
tatactgctataaagagcaagtatgcaagtaaccgactactgatggtcagcacaatccct
cagctgaatggcaagataatcaaggacctggcttcatcactcttaggataa

DBGET integrated database retrieval system