KEGG   Nipponia nippon (crested ibis): 104009246Help
Entry
104009246         CDS       T05756                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04217  Necroptosis
nni04621  NOD-like receptor signaling pathway
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104009246 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104009246 (JAK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104009246 (JAK1)
   05168 Herpes simplex virus 1 infection
    104009246 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104009246 (JAK1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104009246 (JAK1)
Protein kinases [BR:nni01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   104009246 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 Kinase-like RIO1 APH
Motif
Other DBs
NCBI-GeneID: 104009246
NCBI-ProteinID: XP_009459479
LinkDB All DBs
Position
Unknown
AA seq 1153 aa AA seqDB search
MQYLNVKEDCKAMAFCAKMRSTKKSEVNLEAQHQGLEILFYLQDKNPICYTSGEFTSEEL
CIEAAQRCSISPLCHNLFALYDENKRLWYAPNQVFKIDEKTSYRLHYRMRYYFTNWHGTS
ENEPSVWRHSPRKAKNSYEKKLAPEGTPILDANSLEYIFAQGQYDLVKGLAPIRDPKNDE
EVHEIENECLGMAVLAISHYAIKKNVKLPELPKDISYKHYIPETLNKTIRQRNFLTRIRI
NNVFKHFLKEFNNKTICDSSVSPRDLKVKYLSTMETLTKHYGAEIFETSFLLISSENEIN
RFNCGDNEILPLYEVIVTGNNGIQWRLKPNSVQTEKEKKKKSDGKTKKDEEKQKIRDAWN
NFSYFPEITHIVIKESTVSINKQDNKRMELKLSSHDEALSFASLIDGYFRLTADAHHYLC
TDVAPPLIEHNIKNGCHGPICTEYAINKLRQEGNEAGMYVLRWSCTNFNHILMTVTCFEG
SEQMINNSVQYKNFQIEVKKGGYFLHGSNKSFSSLKELMDHLKGQILRTDNISFTLKRCC
QPKPREISNLLVATKKAQEWQPVYHLGQLSFHRILKEEIMQGEHLGRGTRTQIYSGILNY
KDDENEGYQNEKEIKVLLKVLDPSHRDISLAFFETASMMRQVSHKHIVLLHGVCVRDVEN
IMVEEFVEFGPLDLFMHRXXXXLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNILLA
REGIDTEYGPFIKLSDPGIPITVLSRQECVERIPWIAPECVEDSKNLSVAADKWSFGTTL
WEICYNGEIPLKDKTLAEKERFYEGHFVLATPSCKELADLMKQCMNYDPHQRPFFRAIMR
DINKLEEQNPDIVSEKKPVTEVDPTLFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGE
QVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGSGIKLIMEFLPSGS
LKEYLPRNKNKINLKQLLRYAVQICKGMDYLGSRQYVHRDLAARNVLVESENRVKIGDFG
LTKAIETDKEYYTVKDDLDSPVFWYAPECLLQSKFYIASDVWSFGVTLYELLTYCDSESS
PMAEFLKMIGPTQGQMTVARLVRVLQEEKRLPRPPSCPEEVDQLMRKCWIFKHDERTTFH
NLIQGFETIMSKM
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaacgtaaaagaagattgcaaagccatggctttctgtgcaaaaatgagg
agcacaaagaagagtgaagtaaacctggaagctcagcatcagggtttagaaatacttttc
tacctgcaagataaaaatcccatttgttacaccagtggcgagtttacctcggaggagctg
tgcattgaagctgcccagaggtgttccatatctcctctgtgccataatctctttgcactg
tatgacgaaaacaaaagactctggtatgcaccaaaccaggtctttaagatagacgaaaaa
acatcataccggctccattatcgaatgagatactactttacaaactggcatgggactagt
gaaaacgaaccctcagtttggaggcattcaccaaggaaggcaaagaactcttatgagaag
aaactggcgccagaaggaacccctatacttgatgcaaactcattagaatacatctttgcc
cagggtcagtatgacttagtgaaaggcctggcaccaatccgcgatcctaaaaatgatgaa
gaggttcatgaaattgaaaatgaatgcctgggtatggctgtccttgcaatctctcactat
gccatcaagaaaaatgtgaagcttccagagcttcccaaagatatcagttataagcattat
attcccgaaactttgaacaagactatcagacagaggaatttcttaaccaggattcggata
aataatgttttcaaacatttccttaaagagtttaacaacaaaaccatttgcgacagtagt
gtgtctccacgtgatctgaaagttaaatacttgtcaacaatggagaccttgactaaacat
tatggagcagaaatttttgagacttcgtttttgctgatttcatccgagaatgaaataaat
agatttaattgtggagacaatgagatcctccccctatatgaagtcattgtaacaggaaac
aatggaattcagtggaggcttaagccaaattctgtacagacagagaaagagaagaagaaa
aaatctgatggcaaaaccaaaaaggatgaagaaaaacagaaaattcgagacgcatggaac
aatttttcctattttcctgaaatcacccacattgtcatcaaggagtctacagttagcatt
aacaagcaggataacaaaagaatggaattaaaactgtcctcacatgatgaggccctgtcg
tttgcatcgctgatagatgggtacttcagacttacagcagatgcccaccattacctctgc
acagatgtggctcctccactgattgagcacaacataaaaaatggatgccatggacccatt
tgcacagaatatgccatcaacaaactgcgacaggaagggaacgaagcagggatgtatgtg
ttgagatggagctgcacaaacttcaaccacattctcatgacagtgacttgttttgaaggc
tcagagcagatgataaataattcagtccagtacaagaacttccagattgaggtgaagaaa
ggcgggtacttcctacatggttcaaacaagtctttctcatccttaaaagagctgatggat
cacctgaaaggacaaatacttcgaacagacaacataagctttacactgaagaggtgctgc
caaccaaaaccaagagaaatctccaacttgctagttgcaaccaagaaggcacaggaatgg
cagcctgtttatcacctagggcagctgagtttccatcgaatcctcaaggaagaaatcatg
cagggcgaacatcttggaagagggacaagaacacagatttactcagggattctcaactac
aaagatgacgagaatgaaggatatcaaaatgaaaaagagattaaagtcctcctcaaagtc
ttggaccccagccacagagacatttctttggcattctttgaaacggcaagcatgatgagg
caggtgtctcacaagcacattgtcctcctccatggagtctgcgtccgtgatgtagaaaat
atcatggttgaagagtttgttgaatttgggcctctggatctgttcatgcatcgnnnnnnn
nnnntcctgacaactccttggaaattcaaagttgccaagcaacttgcaagtgccctaagc
tacttggaggataaggatttggtacatggaaatgtgtgtactaaaaacatcctactggca
agagagggaattgacactgaatatggtcctttcataaagctgagcgacccaggaatacca
ataactgtgctgtccagacaagaatgcgttgagcgaatcccctggattgcacccgaatgt
gttgaagactccaaaaatttaagcgttgcagcagataaatggagttttggtacaacactg
tgggaaatctgctataatggagaaataccactgaaagacaagacgttagcagagaaggag
aggttctacgaggggcatttcgtgttggcaaccccatcgtgcaaggaactcgctgacctg
atgaaacagtgcatgaactacgacccccatcagagacccttcttcagagcgatcatgaga
gacatcaacaaactggaggaacaaaatcctgatatcgtctcggagaagaagcccgttaca
gaggtcgatcctacgctctttgaaaaacgattcttgaaaagaatccgtgatttgggagag
ggccacttcggcaaggttgaactctgcaggtacgacccagaaggcgacaatacaggagag
caagtagcagttaaatctctaaagccagagagtggagggaatcacatcgctgatctcaag
aaggaaatagaaatcttgaggaatctttatcacgagaacattgtcaaatataagggaatt
tgcacagaagacggaggaagtgggattaaactcatcatggaatttcttccttctgggagc
ctaaaggagtatctcccccggaacaagaacaaaatcaatctcaaacaacttctcagatac
gcggttcagatctgcaagggaatggactatttgggctcccgtcagtacgtgcaccgtgac
ttagcagcaagaaacgtccttgttgaaagcgagaacagagtgaagattggagacttcggt
ctcaccaaagcaatcgagacggataaggagtactacactgtcaaagacgacctcgacagc
cctgttttttggtatgctccagaatgcttgcttcagagtaaattctatatcgcctcggat
gtctggtcgtttggggtgacgctgtacgaactgcttacctactgtgattcggagtccagt
cccatggcagagttcttgaaaatgatcggccccacgcagggacagatgacggtagcacgg
ctggtgcgtgtcttgcaagaagagaagcgtttgccacgtccccccagctgcccagaggag
gtggaccagctgatgaggaagtgctggatattcaagcacgatgaacggacaacctttcac
aatctgattcaaggatttgaaacaattatgagtaaaatgtaa

DBGET integrated database retrieval system