KEGG   Nipponia nippon (crested ibis): 104009322
Entry
104009322         CDS       T05756                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104009322 (GADD45A)
   04068 FoxO signaling pathway
    104009322 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104009322 (GADD45A)
   04210 Apoptosis
    104009322 (GADD45A)
   04115 p53 signaling pathway
    104009322 (GADD45A)
   04218 Cellular senescence
    104009322 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104009322 (GADD45A)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104009322 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104009322 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104009322
NCBI-ProteinID: XP_009459576
LinkDB
Position
Unknown
AA seq 173 aa
MHDLCSEDVPGPRLTRDLAVLPRLLSEGSEAPASQQEWANFALLGPAGTEPEAWGSAWPS
KIKHRDPDNVVLCLLAADEEEAGDAALQIHFTLIQAFCCENDINILRVSNPARLAQLLLP
AAGPEPPADLHCVLVTNPHASQWKDPALSQLMCFCRESRYMDQWVPVINLPER
NT seq 522 nt   +upstreamnt  +downstreamnt
atgcacgacctctgcagcgaggacgtacctggccctcgcttaacgcgtgacctggcggtg
ctcccgcggcttctctccgagggcagcgaagcacctgcgtcgcagcaggagtgggcaaac
ttcgcgttgctcggccccgccggcaccgagccagaggcctggggctcggcctggcctagc
aaaataaaacacagggacccggacaacgtggtgctgtgcctgctggcggccgacgaggag
gaggcgggggacgcggctctgcagatccacttcacgctgatccaggccttctgctgcgag
aacgacatcaacatcctgcgcgtcagcaacccagcgcggctggcccagctcctgctgccc
gccgccggccccgagccgcccgccgacctccactgcgtcctggtgacgaacccccatgcc
tcgcagtggaaggatccagcgctgagtcagctgatgtgcttctgccgggagagtcgctac
atggatcagtgggtgccagtgattaacctccccgagcggtga

KEGG   Nipponia nippon (crested ibis): 104021643
Entry
104021643         CDS       T05756                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104021643 (GADD45B)
   04068 FoxO signaling pathway
    104021643 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104021643 (GADD45B)
   04210 Apoptosis
    104021643 (GADD45B)
   04115 p53 signaling pathway
    104021643 (GADD45B)
   04218 Cellular senescence
    104021643 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104021643 (GADD45B)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104021643 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104021643 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104021643
NCBI-ProteinID: XP_009473517
LinkDB
Position
Unknown
AA seq 113 aa
MGAGGDPDSVVLCLLAADEEDEGDIALQIHFTLIQAFCCDNDIHILRVSGMQRLAAILGE
PEAGAEPRDLHCLLVTNPHTDAWKSQGLAEVASYCAESRDKNQWVPYVCLQER
NT seq 342 nt   +upstreamnt  +downstreamnt
atgggggcagggggggaccccgacagcgtggtgctgtgcctgctggccgccgacgaggaa
gacgaaggcgacatcgccctgcagatccacttcaccctcatccaggccttctgctgcgac
aacgacatccacatcctgcgcgtctcgggcatgcagcgcctggccgccatcctgggcgag
cccgaggcgggcgccgagccccgcgacctccactgcctcttagtcacgaacccacacacg
gacgcctggaagagccaagggttggcggaggtggccagttactgcgccgagagccgcgac
aagaaccagtgggtgccgtacgtctgtctgcaggagcgctga

DBGET integrated database retrieval system