KEGG   Nipponia nippon (crested ibis): 104009342
Entry
104009342         CDS       T05756                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104009342 (PRKAA2)
   04068 FoxO signaling pathway
    104009342 (PRKAA2)
   04150 mTOR signaling pathway
    104009342 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104009342 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104009342 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104009342 (PRKAA2)
   04920 Adipocytokine signaling pathway
    104009342 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104009342 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104009342 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104009342 (PRKAA2)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104009342 (PRKAA2)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104009342 (PRKAA2)
Membrane trafficking [BR:nni04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104009342 (PRKAA2)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104009342 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    104009342 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 104009342
NCBI-ProteinID: XP_009459598
LinkDB
Position
Unknown
AA seq 550 aa
MINLWSLKDRQCLGYVYVGYDGISMGSSWVGEHQLTGHKVAVKILNRQKIRSLDVVGKIK
REIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEAEARRLFQQ
ILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAP
EVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVA
TLLMHMLQVDPLKRATIKDIREHEWFKEELPSYLFPEDPSYDATVIDDDAVREVCEKFEC
TESEVMNSLYSGDPQDQLAVAYHLVIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIPPG
VKPHPERMPPLIADSPKARCPLDALNTTKPKPLTVKKAKWHLGIRSQSKPYDIMAEVYRA
MKQLDFEWKVVNSYHLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDDVMEQRSG
SSTPQRSCSAAGLHRPRLSIDAAAAAECQSLMGSLSGSFVGSIPSVTPRLGSHTMDFFEM
CASLIMALAR
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgatcaatttgtggtccctcaaggaccggcagtgcttgggttatgtttatgttggttat
gatggcatctccatgggctcgagttgggttggcgaacaccagctgacggggcacaaagta
gcagtaaaaatactcaacagacagaaaatacgcagcctggatgtggttgggaagatcaaa
cgagaaattcaaaaccttaagctcttccggcaccctcatattatcaaactgtaccaggtc
atcagcacaccgacggacttcttcatggtcatggaatacgtatctggcggtgaattattt
gattacatctgtaagcatggacgtgttgaagaggcagaagctcgacgccttttccagcag
attctctccgcggtggattactgccacagacacatggttgtccaccgagacctgaaacca
gagaacgtgctgctggatgcacacatgaatgcaaagatagctgattttggcttgtccaac
atgatgtcagatggcgaatttctacgcaccagctgtggttccccaaattatgcagcccct
gaagtcatctctggaaggctgtatgctggcccggaggtggacatctggagctgcggcgtt
atcctctatgcccttctctgcggcactctgcctttcgatgatgaacatgtccccaccctc
ttcaagaagatccggggaggtgtgttttacatccccgaatacctcaatcgctctgttgcc
actctcctcatgcacatgctgcaggttgaccccctcaagcgagcaaccatcaaggacatc
agggaacacgagtggtttaaggaggagctgcccagttacctgttcccagaggacccttct
tatgatgccactgtcatcgatgatgacgcggttcgtgaagtttgtgaaaagtttgaatgc
acggagtcagaggtgatgaacagcctgtacagcggtgaccctcaggaccagctggcggtg
gcttaccaccttgtcattgacaaccggaggatcatgaaccaagccagtgagttctacctt
gcctccagtccccccaccggctccttcatggatgacagcgccatgcacatccctcccggg
gtgaagccacatcccgagcggatgccaccattgatagcggacagccccaaagcacgatgt
cctttggacgctctcaatacaacgaagccaaagcccctgactgtcaaaaaggccaagtgg
cacctgggaatccgaagccagagcaaaccctatgacattatggccgaggtgtaccgcgct
atgaaacagctggacttcgagtggaaggtggtgaactcctaccatctcagagtgcgccgc
aagaatccggtgacgggcaattacgtgaagatgagcctgcagctctaccaggttgacaac
cgcagctatctcttggacttcaaaagcatcgatgatgatgtgatggagcagaggtctggc
tcatctacgccgcagcgctcctgctctgctgccggcttgcaccgcccaaggctgagcatc
gatgccgctgcagctgccgagtgccagtcgctgatgggctctctgagcggctcctttgtc
ggcagcatcccctcggtgacgccgcgcctggggagccacaccatggacttctttgagatg
tgtgccagcctgatcatggccctggctcgctga

KEGG   Nipponia nippon (crested ibis): 104010068
Entry
104010068         CDS       T05756                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104010068 (PRKAG3)
   04068 FoxO signaling pathway
    104010068 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104010068 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104010068 (PRKAG3)
   04920 Adipocytokine signaling pathway
    104010068 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 104010068
NCBI-ProteinID: XP_009460415
LinkDB
Position
Unknown
AA seq 305 aa
MHFMRSHCCYDAVPTSCKLVVFDISLEIKKAFVALVANGVRAAPLWDSKTQSFVGMLTIT
DFINILHRYYRSPLVQIYEVEEHKIETWREVYLQGSFKPLVYISPSNSLFDAVYSLIKHK
IHRLPVIEPVSGNVLHILTHKRILKFLHIFGSTIPKPRFLKKTVQELCVGTFRDVAVVPE
TAPVYAALEIFVDRRVSALPVINDAGQVVGLYSRFDVIHLAAQKTYNNLDISVREALRQR
TTCLEGVLTCYPHETMEDIIDRIAKEQVHRLVLVDENQYPRGIVSLSDILQALVLTPAGI
DRSSL
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcacttcatgaggagccactgctgctacgacgccgtccccaccagctgcaagctcgta
gtcttcgacatctccctggagatcaagaaagccttcgtggcactggtggccaacggggtg
cgtgccgccccgctctgggacagcaagacacagagctttgtggggatgctcaccatcacc
gacttcatcaacatcctccaccgttactaccgctcgcccctggttcagatctacgaggtg
gaggagcacaagattgagacctggcgagaggtgtacctgcagggctccttcaaaccactg
gtctacatctccccgagcaatagcctcttcgacgccgtctactccctgatcaagcacaag
atccaccgcctgcccgtcatcgagcccgtctcgggcaacgtcctgcacatcctgacgcac
aagcgcatcctcaagttcctccacatctttggctccaccatccccaagccgcgctttctg
aagaaaacagtgcaggagttgtgtgttggcaccttccgcgacgtggccgtcgtgcctgag
accgcccctgtctatgccgctctggagatcttcgtggaccgccgtgtctccgccttgccc
gtcatcaacgatgctgggcaagtggtcggcctctactcccggtttgacgtcattcacctg
gcagcccagaagacctacaacaacctggacatcagcgtgcgggaggcgctgcggcagcgc
accacctgcctggagggggtcctcacctgctacccccacgaaaccatggaggacatcatc
gaccgcatcgccaaggagcaggtccatcgcctggttctggtggatgagaaccagtacccg
cggggcatcgtctccctctccgacatcctccaggcccttgtgctcactcccgcaggcatc
gaccgatcctcactctga

KEGG   Nipponia nippon (crested ibis): 104010405
Entry
104010405         CDS       T05756                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2 isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104010405 (PRKAB2)
   04068 FoxO signaling pathway
    104010405 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104010405 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104010405 (PRKAB2)
   04920 Adipocytokine signaling pathway
    104010405 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 104010405
NCBI-ProteinID: XP_009460790
UniProt: A0A091UX29
LinkDB
Position
Unknown
AA seq 274 aa
MGNTTSERVSGERHGSKSHRSDGSGAPHPTKEHPHKIMVGSTDDPSVFSSHDSKIPGDKE
FVSWQPDLEESVKPSQQARPTVIRWADGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDL
PEGEHQYKFFVDGQWVHDPSEPVVTSQMGTINNLIHVKKSDFEVFDALKVDSLESSETSG
RDLSSSPPGPYGQEMYVYRPEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVML
NHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 825 nt   +upstreamnt  +downstreamnt
atggggaacaccaccagtgagcgagtgtctggggagcgccatggctccaagtcccaccgc
tcggacggctccggtgccccccaccccaccaaggagcacccgcacaagatcatggtgggc
agcaccgacgaccccagtgttttcagctcccatgactccaagattcctggggacaaggag
tttgtgtcgtggcagccagatctggaggagtcagtgaaaccatcccaacaggctcgtccc
actgtcatccgctgggccgatggaggcaaagaggtcttcatctccggatctttcaacaac
tggagcaccaagatcccgctcattaagagccacaacgactttgtcgctatcctggacctc
ccagaaggagagcaccagtacaaattttttgtggacggccagtgggtccatgacccgtct
gagcctgtggtcaccagccagatggggacgattaacaacctgattcacgtcaaaaagtct
gactttgaggtgttcgatgcattgaaggtggattccctggagagctcagaaacctcaggt
cgggacttatcaagctcaccacctggtccttacggccaagagatgtatgtataccggccc
gaggagcgcttcaaatccccacccatcctcccgcctcacctcctccaggtcatcctcaac
aaggacaccaatatctcgtgtgacccagcactgctgcctgaacccaaccacgtcatgctc
aatcacctctacgcgctctccatcaaggatggcgtgatggtgctcagcgccacgcaccgc
tacaagaagaagtacgtcaccacactgctgtacaagcccatctga

KEGG   Nipponia nippon (crested ibis): 104011465
Entry
104011465         CDS       T05756                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1 isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104011465 (PRKAB1)
   04068 FoxO signaling pathway
    104011465 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104011465 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104011465 (PRKAB1)
   04920 Adipocytokine signaling pathway
    104011465 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 Phage_glycop_gL
Other DBs
NCBI-GeneID: 104011465
NCBI-ProteinID: XP_009462001
LinkDB
Position
Unknown
AA seq 275 aa
MGNTSSERAGLERHGHKASRGDNSGGAISTKDGDRPKILMDSPEDADLFHSEEMKAPLEK
EEFLAWQQDLEVNDKTPTQARPTVFRWTGGGKEVYLSGSFNNWSKIPLTRSHNNFVAILD
LPEGEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDIS
LAELSSSPPGPYHQEPYVCKAEERFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVM
LNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggggaacacaagcagtgagcgagcaggactggagcgtcatgggcataaggcatcccga
ggtgacaactcaggaggagccatcagtacgaaagacggtgatagaccaaaaattttaatg
gacagtcctgaagatgcagacttgttccattcggaggaaatgaaggctccattggagaaa
gaagaattcctagcttggcaacaagatctggaagtgaacgataaaactcccactcaagct
cgaccaacagtctttcgctggactggaggagggaaagaagtttatttatctgggtccttc
aacaactggagtaaaattcctctgacaaggagtcacaataactttgtggcaatcctggac
ctgccagaaggagagcaccaatacaagttctttgtggatgggcagtggacgcacgatcct
tcagagccagtagtaaccagccagctaggtaccgtcaacaacatcatacaggtgaagaaa
actgactttgaagtattcgatgctttgatggtggactcccaaaaatgttcagacatctct
ctggcagagctgtcaagttcacccccaggaccgtaccaccaggagccctatgtttgtaag
gcagaggagcgctttaaatcaccgcctattctccccccccacctgctgcaggtcatcctg
aataaggacactggcatttcttgcgatcccgctctactccctgaacccaaccatgtcatg
ctgaaccacctctacgcgctttctatcaaggatggagtgatggtgcttagtgctacgcat
cgttacaagaagaaatacgtgactactttgctgtacaagccaatatga

KEGG   Nipponia nippon (crested ibis): 104013818
Entry
104013818         CDS       T05756                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104013818
   04068 FoxO signaling pathway
    104013818
   04150 mTOR signaling pathway
    104013818
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104013818
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104013818
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104013818
   04920 Adipocytokine signaling pathway
    104013818
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104013818
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104013818
   03029 Mitochondrial biogenesis [BR:nni03029]
    104013818
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104013818
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104013818
Membrane trafficking [BR:nni04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104013818
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104013818
  Mitophagy factors
   Other mitophagy factors
    104013818
SSDB
Motif
Pfam: AdenylateSensor ECH_1
Other DBs
NCBI-GeneID: 104013818
NCBI-ProteinID: XP_009464632
LinkDB
Position
Unknown
AA seq 286 aa
MDADQLAVQREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECTEEEVLSCLYS
RNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLSRPHPERVPFLVAEAPR
PRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLR
VRRKNPVTSAYSKMSLQLYQVDSRTYLLDFRSIDGSRPNLGPLAMRVAKLAINQEMEARS
IFSIKVDLVTGLAIEEACYAQTIPTKDRIEGLLAFKEKRPPCYKGE
NT seq 861 nt   +upstreamnt  +downstreamnt
atggatgcagaccaactggcagtgcagagggaacatgaatggtttaagcaggaccttccg
aaatacttgtttcctgaagacccatcatatagctctaccatgattgatgatgaagcctta
aaagaagtgtgtgagaagtttgaatgcactgaagaggaagtgctaagttgtctatacagc
cgaaatcatcaggaccctttagcggttgcttatcacctcattatagataatagaagaata
atgaatgaggccaaagacttctacttggctacaagcccaccggattcttttcttgatgat
caccatctgtctcgccctcatcctgaaagagtgccattcttagtagctgaagcaccacgt
cctcgccatactcttgatgagctgaatccacagaagtcaaaacaccaaggtgtaagaaga
gctaagtggcacttgggaatacggagtcagagtcgaccaaatgatatcatggctgaagtt
tgtcgtgcaattaaacaactagattatgaatggaaggttgtaaatccgtactatttacgt
gttcgaaggaagaatccggtaacaagtgcatattccaaaatgagtctacagctgtatcag
gtggacagcaggacatacttactggacttccgtagcattgatggatcaaggcctaatctg
ggaccactggcaatgagagttgcaaaactggccatcaatcaggaaatggaggcaagatct
atattttccataaaagttgatttggtaacaggtttagcaattgaagaagcttgttatgct
cagactattccaacaaaagatagaattgaaggtcttcttgcatttaaggagaaaagacct
ccttgctacaagggagaataa

KEGG   Nipponia nippon (crested ibis): 104014891
Entry
104014891         CDS       T05756                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104014891 (PRKAG2)
   04068 FoxO signaling pathway
    104014891 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104014891 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104014891 (PRKAG2)
   04920 Adipocytokine signaling pathway
    104014891 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 104014891
NCBI-ProteinID: XP_009465846
LinkDB
Position
Unknown
AA seq 452 aa
MLQLMKRFGSFRGSKKRKEQCKSLERRQSDPRGLFASGLSSSPSTPTQVTKQPTFPLESY
KHEPERLETRIHCSSPPDTGQRFSLPPSQSAAKPPIMTPAPCATSKPAAAAAPAPSQLPA
ASEGMLEKLELEDEALEESESDIYVRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALV
ANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQET
FKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFMSEMPK
PAFMKKNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFD
VINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSMLETLETIVDRIVKAEVHRLVVVNE
ADSIVGIISLSDILQALVLTPAGAKQKENESE
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgttgcagctcatgaagcgttttggtagctttagagggagcaagaagagaaaggagcag
tgcaaaagcttggagagacgccagtctgatcctcgtggcctgttcgcctctggcctctcc
tcttctccatctaccccaacccaagtgaccaagcagcccacgtttcctcttgaatcctat
aagcatgagcctgagagactagaaacacggattcactgttcttcacctccggacacaggg
cagagattttctttgcctccatctcaaagtgcagccaagcctcccatcatgacaccagct
ccctgtgctacctcaaaaccagcggcggcagcggctccggctccctctcagctcccggcc
gcctccgaagggatgctggagaaactagagctcgaagatgaagcacttgaagaatcggaa
agtgacatttatgtgcgattcatgaggtcacacaagtgttatgacattgttccaacaagc
tctaagcttgttgttttcgacactacgctacaagtaaagaaagccttttttgccttggtg
gcaaacggtgtgagagcagctccactgtgggagagtaaaaaacagagttttgtaggaatg
ttaacaattacagatttcattaacatactgcatagatactataagtctccaatggttcag
atttatgaattggaggagcacaagatagaaacctggagggagctttatttacaagagaca
tttaaacctttagtgaacatctccccagatgcaagcctttttgatgctgtatattcattg
atcaaaaacaaaatccacagattgccagttatagatcccgtcagtggaaatgcactttat
atacttacccataaaagaatcctcaagttcctccagctttttatgtcagagatgccaaag
cctgcctttatgaagaagaatctggatgaacttggaataggaacttaccacaacattgcc
ttcatacatccagacactcctatcattaaagccttgaatatatttgtagagagaaggata
tcggcattacctgttgtggatgagtcaggaaaagttgtagatatttattccaaatttgat
gtaataaatcttgctgctgaaaaaacatataataacctagatatcacggtgacgcaagcc
ctacagcaccgttctcagtattttgaaggtgttgtaaagtgtagtatgctggaaacactg
gagaccattgtggatagaatagtgaaggctgaggttcatcgtttggtggtagtgaatgaa
gcagatagcattgtgggtatcatctccctttctgacattctacaagctttggtactcaca
ccagcaggtgccaaacaaaaggagaacgaaagcgaatga

KEGG   Nipponia nippon (crested ibis): 104016188
Entry
104016188         CDS       T05756                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104016188 (PRKAA1)
   04068 FoxO signaling pathway
    104016188 (PRKAA1)
   04150 mTOR signaling pathway
    104016188 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104016188 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104016188 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104016188 (PRKAA1)
   04920 Adipocytokine signaling pathway
    104016188 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104016188 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104016188 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104016188 (PRKAA1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104016188 (PRKAA1)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104016188 (PRKAA1)
Membrane trafficking [BR:nni04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104016188 (PRKAA1)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104016188 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    104016188 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 104016188
NCBI-ProteinID: XP_009467299
LinkDB
Position
Unknown
AA seq 535 aa
MVFSTGLLAISVQVDKGEVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRH
PHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH
MVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGP
EVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDP
MKRATIRDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECTEEEVLSCLYS
RNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLSRPHPERVPFLVAEAPR
PRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLR
VRRKNPVTSAYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQ
KDSDADAQGKSADTSLTSSVSSSLDSSTADLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggtgttcagcacaggtctgttagcaatatccgttcaagtggacaagggtgaagttggc
aaacatgagttaactgggcataaagttgcagtgaagatcctgaatcgacagaagattcgc
agccttgatgttgtaggaaaaatccgcagggagattcagaacctcaaactcttcaggcat
cctcatataattaagctgtaccaggtcatcagtacaccaacagacattttcatggtgatg
gaatatgtttcaggaggagaactgtttgattatatctgtaaaaatggaaggcttgatgag
aaggaaagtagacgtctgttccagcaaatcctttctggtgtggattactgccacaggcat
atggtagtacatagagatctgaagcctgaaaatgtgctccttgatgcgcacatgaatgcc
aagatagctgactttggtctatcaaatatgatgtcagatggagaatttttaagaacaagc
tgtggctcccctaactatgctgcaccggaagtaatttcaggaagattatatgcaggtcca
gaagtagatatttggagcagtggggttattctctatgctttgttatgtggaacacttcca
tttgatgatgatcacgtgccaaccctttttaagaagatatgtgatggtatcttttatacc
cctcagtacctgaatccgtctgtaattagtcttttgaagcacatgctgcaagtggatcca
atgaagagagcaacaatcagagacattagggaacatgaatggtttaagcaggaccttccg
aaatacttgtttcctgaagacccatcatatagctctaccatgattgatgacgaagcctta
aaagaagtgtgtgagaagtttgaatgcactgaagaggaagtgctaagttgtctatacagc
cgaaatcatcaggaccctttagcggttgcttatcacctcattatagataatagaagaata
atgaatgaggccaaagacttctacttggctacaagcccaccggattcttttcttgatgac
caccatctgtctcgccctcatcctgaaagagtgccattcttagtagctgaagcaccacgt
cctcgccatactcttgatgagctgaatccacagaagtcaaaacaccaaggtgtaagaaga
gctaagtggcacttgggaatacggagtcagagtcgaccaaatgatatcatggctgaagtt
tgtcgtgcaattaaacaactagattatgaatggaaggttgtaaatccgtactatttacgt
gttcgaaggaagaatccggtaacaagtgcatattccaaaatgagtctacagctgtatcag
gtggacagcaggacatacttactggacttccgtagcattgatgatgaaattactgaagcg
aagtctgggactgcaactccacagagatcaggttctgtgagcaactacagatcctgtcaa
aaagattcagatgctgatgcacaaggaaaatctgcagatacatcccttacctcatcagtg
agctcttcacttgactcttctacagctgacttaactccaagaccagggagtcatacaata
gaattttttgagatgtgtgcaaatcttattaaaatacttgcacaataa

KEGG   Nipponia nippon (crested ibis): 104017939
Entry
104017939         CDS       T05756                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104017939
   04068 FoxO signaling pathway
    104017939
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104017939
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104017939
   04920 Adipocytokine signaling pathway
    104017939
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 104017939
NCBI-ProteinID: XP_009469293
LinkDB
Position
Unknown
AA seq 161 aa
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSPMVQIYELEEHKIETWRELYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVIDPDSGNTLYILTHKRILKFLKLFVSPVPAPRRRRGPP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaagtcccaccgctgctacgacctgatccccaccagctccaaactggtcgtcttcgac
acttccctgcaggtgaagaaggctttctttgcgctggtcaccaacggcgtgcgggccgcc
ccgctgtgggacagcaagaagcaaagcttcgtgggcatgctgaccatcaccgacttcatc
aacatcctgcaccgctactacaagtcgcccatggtgcagatctatgagctggaggagcac
aaaatagagacgtggagagagctctacctacaagactccttcaagccgcttgtctgcatc
tcccccaacgccagcctctttgacgccgtctcctccctgatccggaacaagatccaccgc
ttgcccgtcatcgaccccgactcggggaacacactctacatcctcacccacaaacgcatc
ctcaagttcctcaaactctttgtaagtcccgtccctgccccgcggcggcggcgggggccg
ccctga

KEGG   Nipponia nippon (crested ibis): 104019864
Entry
104019864         CDS       T05756                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104019864
   04068 FoxO signaling pathway
    104019864
   04150 mTOR signaling pathway
    104019864
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104019864
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104019864
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104019864
   04920 Adipocytokine signaling pathway
    104019864
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104019864
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104019864
   03029 Mitochondrial biogenesis [BR:nni03029]
    104019864
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104019864
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   104019864
Membrane trafficking [BR:nni04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104019864
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104019864
  Mitophagy factors
   Other mitophagy factors
    104019864
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo FTA2
Other DBs
NCBI-GeneID: 104019864
NCBI-ProteinID: XP_009471481
LinkDB
Position
Unknown
AA seq 519 aa
LAVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDI
FMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDA
YMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLC
GTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIRNIREHEWFK
QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECTEEEVLSCLYSQNHQDPLAVAYHLIID
NRRIMNEAKDFYLATSPPDSFLDDHHLSRPHPERVPFLVAEAPLPRHTLDELNPQKSKHQ
GVRRAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRKKNPVTSAYSKMSL
QLYQVDSRTYLLDFRSIDDEITEAKSGTATPRRSASVSNCRSCQKDSDADAQGKLADISL
IPSVTSSLDFSKADLNPRPGSHTIEFFEMCANLIKILAQ
NT seq 1560 nt   +upstreamnt  +downstreamnt
cttgcagttggcaaacatgagttaactgggcataaagttgcagtgaagatcctgaatcga
cagaagattcgcagccttgatgttgtaggaaaaatccgcagggagattcagaacctcaaa
ctcttcagacatcctcatataattaagctgtaccaggtcatcagtacaccaactgacatt
ttcatggtgatggaatatgtttcaggaggagaactgtttgattatatctgtaaaaatgga
aggcttgatgagaaggaaagtagacgtctgttccagcaaatcctttctggtgtggattac
tgtcacaggcatatggtagtacatagagatctgaagcctgaaaatgtgctgcttgatgca
tacatgaatgcaaagatagctgactttggtctatcaaatatgatgtcagatggagaattt
ttaagaacaagctgtggttcccctaactatgctgcaccagaagtaatttcaggaagatta
tatgcaggtccagaagtagatatttggagcagtggggttattctctatgctttgttatgt
ggaacacttccatttgatgatgatcatgtgccaaccctttttaagaagatatgcgatggt
atcttttatacccctcagtacctgaatccatctgtaattagtcttctgaaacacatgctg
caagtagatccaatgaagagagcaacaatcagaaacattagggaacatgaatggtttaag
caggaccttccgaaatacttgtttcctgaagacccatcatatagttctaccatgattgat
gatgaagccttaaaagaagtgtgtgagaagtttgaatgcactgaagaggaagtgctaagt
tgtctatacagccaaaatcatcaggaccctttagcggttgcttatcacctcattatagat
aatagaagaataatgaatgaggccaaagacttctacttggctacaagcccaccggattct
tttcttgatgatcaccatctgtctcgccctcatcctgaaagagtgccattcttagtagct
gaagcaccacttccccgccatacacttgatgagttgaatccacagaagtcaaagcaccaa
ggtgtaagaagagctaagtggcacttgggaatacggagtcagagtcgacctaatgatatc
atggctgaagtttgtcgagcaattaaacaactggattatgaatggaaggttgtaaatcca
tactatctgcgtgttcgaaagaagaatccagtgacaagtgcatattccaaaatgagtcta
cagttgtatcaggtggacagcaggacatacttactggacttccgtagcattgatgatgaa
attactgaagcaaaatctgggactgcaactccacggagatcagcttctgtgagcaactgt
agatcctgtcaaaaagattcagatgctgatgcacagggaaaattggcagatatatccctt
atcccatcagtgacctcttcacttgacttttctaaagctgacttaaatccaagaccaggg
agtcatacaatagaattctttgagatgtgtgcaaatcttattaaaatacttgcacaataa

DBGET integrated database retrieval system