KEGG   Nipponia nippon (crested ibis): 104009408
Entry
104009408         CDS       T05756                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04530  Tight junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104009408 (CCND1)
   04340 Hedgehog signaling pathway
    104009408 (CCND1)
   04371 Apelin signaling pathway
    104009408 (CCND1)
   04068 FoxO signaling pathway
    104009408 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104009408 (CCND1)
   04115 p53 signaling pathway
    104009408 (CCND1)
   04218 Cellular senescence
    104009408 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104009408 (CCND1)
   04530 Tight junction
    104009408 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104009408
NCBI-ProteinID: XP_009459668
UniProt: A0A091UUS5
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattaggcccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccgcct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system