KEGG   Nipponia nippon (crested ibis): 104009408
Entry
104009408         CDS       T05756                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04530  Tight junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104009408 (CCND1)
   04340 Hedgehog signaling pathway
    104009408 (CCND1)
   04371 Apelin signaling pathway
    104009408 (CCND1)
   04068 FoxO signaling pathway
    104009408 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104009408 (CCND1)
   04115 p53 signaling pathway
    104009408 (CCND1)
   04218 Cellular senescence
    104009408 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104009408 (CCND1)
   04530 Tight junction
    104009408 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104009408
NCBI-ProteinID: XP_009459668
UniProt: A0A091UUS5
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattaggcccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccgcct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

KEGG   Nipponia nippon (crested ibis): 104013148
Entry
104013148         CDS       T05756                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04510  Focal adhesion
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104013148 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104013148 (CCND3)
   04115 p53 signaling pathway
    104013148 (CCND3)
   04218 Cellular senescence
    104013148 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104013148 (CCND3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104013148 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C Herp-Cyclin
Other DBs
NCBI-GeneID: 104013148
NCBI-ProteinID: XP_009463887
LinkDB
Position
Unknown
AA seq 211 aa
MNYVDRYLSSVSMRKNHLQLLGAVCMLLASKLRETMPLTVEKLCIYTDNSITPQQLLDWE
VLVLEQLKWDLVSVIANDFLAHILHHLPLPEDKMELVKKHAQTFIALCATDYTFAMYPPS
MIATGSIGAAIHGLTVSVNDFTGEAITELLASITGTEVDCLKACQEQIEAALAESLKQAS
QTQQEYRATKTAAYPASQPTGTPTDVTDINL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaattacgtggatcgctacctgtcgtcggtctccatgcggaaaaatcacttgcagctt
ctgggggcggtctgcatgctcctggcttccaagctgcgagaaaccatgcccctgaccgtg
gagaaactctgcatttacacagacaactccatcacgcctcagcagctcctggattgggaa
gttctagtcctggagcagctgaagtgggacctggtctcagtgatagcgaatgatttcttg
gctcacatcctccatcacctcccgctgcctgaggacaagatggagctggtgaagaaacac
gcacagaccttcatcgccctgtgtgccacggactacactttcgccatgtaccccccctcc
atgattgcgaccggcagtattggagcggcgatccacggcctgacggtctccgtgaatgat
ttcaccggcgaggcgatcaccgagctgctggccagcatcactggcacggaggtggactgc
ctgaaagcctgtcaggagcagattgaggcagccttagccgagagcctgaaacaagcgtcc
caaacccaacaggaataccgggccaccaagactgctgcttacccggccagccagcccacc
ggcacgcccacagacgtcacggacatcaacctgtga

KEGG   Nipponia nippon (crested ibis): 104021822
Entry
104021822         CDS       T05756                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2 isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
nni04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104021822 (CCND2)
   04340 Hedgehog signaling pathway
    104021822 (CCND2)
   04068 FoxO signaling pathway
    104021822 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104021822 (CCND2)
   04115 p53 signaling pathway
    104021822 (CCND2)
   04218 Cellular senescence
    104021822 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104021822 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 104021822
NCBI-ProteinID: XP_009473710
LinkDB
Position
Unknown
AA seq 285 aa
MELLCCEVDPMRRALPDPNLLYDDRVLHNLLTIEERYLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPLPKDKLLLIRKH
AQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDDGDSLTDLLAKITNTDVDCLKAC
QEQIEAVLVNSLRQVRQQQQQSNPSKTVDELDQASTPTDVRDINL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggatcccatgaggagagctctgcctgacccaaacttg
ctctacgatgaccgcgttttgcacaacttactaaccatagaggagaggtatctgccccaa
tgctcctacttcaagtgcgtccagaaggacatccagcccttcatgaggaggatggtggcc
acttggatgctggaggtctgtgaagagcagaagtgcgaagaagaagttttccctctggcc
atgaattacttggacagattcttagctgtggtgcccactcgaaagtgccatctgcaactg
ctgggggcagtctgcatgttcctggcctccaagctgaaagagacaatccccctcacagcc
gagaagctgtgcatatatacggacaattccatcaaaccccaagagctgctggaatgggag
ctggtggtgctggggaagttgaagtggaacctcgcagctgtcaccccgcacgatttcatt
gaacacatcctaaggaagctgcctctaccgaaagacaagttgcttttgatccggaagcat
gcacaaacattcattgccctttgtgccacagattttaactttgccatgtacccaccgtca
atgatagcaactggaagtgtgggagcagccatctgtggccttcagcttgatgacggggac
agcctcacggacctcctggccaagatcacaaacacagatgtggactgccttaaagcttgt
caagaacagatcgaggcggtgctagtaaacagccttaggcaagtccggcagcagcaacag
caaagcaatccttctaagacggtggacgaactggaccaggccagcactcccacagatgtg
agagatatcaacctgtga

DBGET integrated database retrieval system