KEGG   Nipponia nippon (crested ibis): 104009927
Entry
104009927         CDS       T05756                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04217  Necroptosis
nni04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104009927 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104009927 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104009927 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104009927 (STAT3)
Transcription factors [BR:nni03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104009927 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha Tropomyosin_1
Other DBs
NCBI-GeneID: 104009927
NCBI-ProteinID: XP_009460241
LinkDB
Position
Unknown
AA seq 754 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGVKTLPGPWESLNESSKE
GGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPD
IPKEEAFGKYCRSESQEHSEATDSGAAPYLKTKFICVTPTSFSNTIDLPMSPRTLDSLMQ
FGNSSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagctttcccatggagctccggcagttcctggccccgtggattgagagc
caggactgggcgtacgctgccagcaaggagtcgcacgccacgctggtgttccacaacctg
ctgggggagattgaccagcagtacagccgcttcctgcaggagtccaacgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagcccgcatcgtggctcgctgcctgtgggaagagtcacggctcctccagacagctgcc
accgcagcccagcaaggtggacaggcaacacatccaacagcagctgtagtgacagaaaag
cagcagatgctggagcagcatctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcggtgacccggcagaaaatg
cagcagctggaacagatgctcacggcgctggaccaaatgcgaaggggtattgtgagcgag
ctggctggactgctgtcagccatggagtatgtgcagaagatgctggcagatgaggaactg
gcagactggaagagacggcagcagattgcctgcattggcggcccaccgaatatctgctta
gaccggcttgagaattggataacctctcttgctgaatcacagctacagacccgacagcag
atcaagaagttggaagaactgcagcagaaagtgtcctacaagggtgacccgattgtccaa
caccggcccatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagcgct
ttcgtcgtggagaggcagccctgcatgcccatgcaccccgaccggcccctggtcatcaaa
accggcgtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaattaaagtctgcattgacaaggactccggggatgttgcagcacttcgaggg
tcccggaagtttaacatcctggggacaaacaccaaggtcatgaacatggaggagtcaaac
aacggcagcctctcagcagagttcaagcacctgaccctgcgggagcagcgatgcggtaac
ggaggcagagccaactgcgatgcctcgttgatagtcactgaggagctgcacctcatcacc
ttcgagacagaggtgtatcaccaggggctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccatcgggacc
tgggaccaggtggcagaggtgctgagctggcaattctcctccaccacgaagcgtggcctc
agcatcgagcagctgacaacgctggcagaaaagcttctagggccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctcg
ttctgggtctggctggacaacatcattgacttagtgaaaaagtacatcctggcgctgtgg
aacgaaggggtgaaaaccctccctggcccttgggaatccctcaatgagagcagcaaggaa
ggcggcatcaccttcacgtgggtggagaaggacatcagcgggaagacccagatccagtct
gtggagccttacaccaagcagcagctgaacaacatgtcatttgcggagatcatcatgggc
tacaaaatcatggatgccaccaacatcctggtgtcccccctggtgtacctgtacccagac
atccccaaggaggaggcgtttgggaagtactgccgctccgagagccaggagcactcggaa
gccacggactcaggtgctgctccgtatctgaagaccaagttcatctgtgtcacccccacc
tccttcagcaacaccatcgacctgcccatgtccccgcgcaccctggactcgctcatgcag
tttggcaacagcagcgagggagcggaggccaatgcaggagggcagtttgagtcgctgacc
ttcgacatggagctgacaccggagtgtgcttcttcacccatgtga

DBGET integrated database retrieval system