KEGG   Nipponia nippon (crested ibis): 104010338
Entry
104010338         CDS       T05756                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010338 (MAPK13)
   04370 VEGF signaling pathway
    104010338 (MAPK13)
   04068 FoxO signaling pathway
    104010338 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104010338 (MAPK13)
   04218 Cellular senescence
    104010338 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104010338 (MAPK13)
   04621 NOD-like receptor signaling pathway
    104010338 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    104010338 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    104010338 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104010338 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    104010338 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104010338 (MAPK13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104010338 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104010338 (MAPK13)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104010338 (MAPK13)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104010338 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like DUF3754 FTA2
Other DBs
NCBI-GeneID: 104010338
NCBI-ProteinID: XP_009460723
LinkDB
Position
Unknown
AA seq 365 aa
MNIARRRGFYRQEVNKTLWELPRRYTSLHPVGSGAYGSVCSAIDKKTGEKVAIKKLCRPF
QSEIFAKRAYRELMLLKHMQHENVIGLLDVFTSATSFQGFQDFYLVMPYMRTDLQKIMGH
EFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCQLKILDFGLARHADAEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSIGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
HPGEDFVEKLEDKAAKSYIKSLPKIPKKDLSVLFPKANPQAVDLLDKMLQLDVEKRLTAT
EALAHPYFDQFRDVEEETEAQESYDDSLEHEKLSIDEWRKHIYKEILSFSPIARKDSKKR
SGMSL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaacatcgcaaggagaagaggcttctacagacaggaggtgaacaaaaccctctgggag
ctgcccaggagatacacgtccctccaccccgtggggtccggagcctacggctcggtgtgt
tcagccatagacaagaagacaggggagaaagtggctatcaagaagctctgccgcccattc
cagtcggagatcttcgccaagagagcatacagagagctcatgctgctgaagcacatgcag
cacgagaacgtcattgggctgcttgatgtcttcacctccgccacctccttccagggattc
caggacttctacctggtgatgccatacatgcggacagatttacaaaagatcatgggacat
gaattcagtgatgaaaagatccagtacctggtctaccaaatgctgaaagggctgaagtat
attcattcagccggaatcatccacagggacctgaagccaggcaacctggctgtgaatgaa
gactgtcagctaaagatcttggattttggcttggccagacacgctgatgctgaaatgacc
ggctacgtggttacgcgctggtacagagccccagaagtcattctgaactggatgcattac
aaccagacagtggatatctggtctattggctgcatcatggcagaaatgctgactgggaaa
acgctgtttaaaggaaaagactacctagatcaactgactcagatcctgaaagtaacgggg
catccaggagaagacttcgtggagaagctggaggacaaagcggctaagagttatatcaag
tcccttcctaaaatccccaagaaggatttgtctgtgcttttccccaaagccaacccgcag
gcagtggacctgcttgacaagatgttgcagctggatgtggaaaagcgccttacagcgacg
gaggcgttggctcacccctatttcgaccagttccgagacgttgaggaggagacagaagcg
caagagtcctatgatgattctctggaacatgaaaagctttcgatagatgagtggagaaag
catatttacaaggagatcttgtcgttcagtcccattgcacggaaggactcaaagaagcga
agtgggatgtcgttgtag

KEGG   Nipponia nippon (crested ibis): 104010702
Entry
104010702         CDS       T05756                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010702 (MAPK11)
   04370 VEGF signaling pathway
    104010702 (MAPK11)
   04068 FoxO signaling pathway
    104010702 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104010702 (MAPK11)
   04218 Cellular senescence
    104010702 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104010702 (MAPK11)
   04621 NOD-like receptor signaling pathway
    104010702 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    104010702 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    104010702 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104010702 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    104010702 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104010702 (MAPK11)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104010702 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104010702 (MAPK11)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104010702 (MAPK11)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104010702 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 104010702
NCBI-ProteinID: XP_009461129
LinkDB
Position
Unknown
AA seq 287 aa
MTICHIFVIGLLDVFTPATSIENFNEVYLVTNLMGADLNNIVKCQKLTDDHIQFLIYQLL
RGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTGYVATRWYRAPEIML
NWMHYNQTVDIWSVGCIMAELLKGKALFPGDDYIDQLKRIMEVVGTPSSELLKKISSEHA
RKYIESLPHMPQQDLKAVFRGANPLAVDLLEKMLILDSDKRITASEALAHPYFVQYHDPD
DEPEAELYDESIENKERTIDEWKELTYEEVISFKPPDLKMDSLEIEQ
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaccatatgtcatatttttgttataggattgctagatgtttttacacctgcaacatca
atagaaaattttaatgaagtgtatcttgtgacaaatttaatgggtgctgacctgaataac
attgtgaagtgccagaagttaacggatgaccatatacagtttctcatctatcagttactt
cgaggtcttaagtatattcactcagctggaatcatccaccgggacctgaagcccagtaac
ctagccgtaaatgaagactgtgaattgaggattttagactttggtttagcgcgacaaact
gatgatgaaatgaccgggtatgttgcaacaagatggtacagagctccagaaattatgtta
aactggatgcactacaatcaaacagttgacatctggtcggttggatgcatcatggcagag
ctattgaaagggaaggccctatttccaggagatgattatatcgatcagctaaagagaata
atggaagttgtgggcacacccagttctgaacttctgaagaagatatcatcagaacatgca
agaaaatacattgaatctcttccacatatgcctcaacaggatttgaaagcagtatttcgt
ggtgccaatccattagctgtagatcttcttgagaagatgcttatattagacagtgataaa
agaattactgcctcggaagcacttgcacatccatactttgtacagtatcacgatccagat
gatgaacctgaggccgagctgtacgatgagtcaatagagaataaggagcgaaccatagat
gaatggaaagaactcacctatgaagaagtgattagctttaaaccccccgacttaaaaatg
gatagcctggagatagaacagtga

KEGG   Nipponia nippon (crested ibis): 104010773
Entry
104010773         CDS       T05756                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010773 (MAPK12)
   04370 VEGF signaling pathway
    104010773 (MAPK12)
   04068 FoxO signaling pathway
    104010773 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104010773 (MAPK12)
   04218 Cellular senescence
    104010773 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104010773 (MAPK12)
   04621 NOD-like receptor signaling pathway
    104010773 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    104010773 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    104010773 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104010773 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    104010773 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104010773 (MAPK12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104010773 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104010773 (MAPK12)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104010773 (MAPK12)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104010773 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like UvrD_C DUF3381 FTA2
Other DBs
NCBI-GeneID: 104010773
NCBI-ProteinID: XP_009461216
LinkDB
Position
Unknown
AA seq 332 aa
MQPLASPGGCSAVDGRSGTKVAIKKLYRPFQSELFAKRAYRELRLLKHMKHENVIGILDV
FTPDVTLEKFNDFYLVMPFMGTDLSKIMKHEKLTEDRIQFLVYQMLKGLKYIHSSGIIHR
DLKPGNLAVNEDCELKILDFGLARHTDSEMTGYVVTRWYRAPEVILNWMHYTQTVDIWSV
GCIMAEMITGRPLFKGNDHLDQLTEIMKITGTPTQDFVQKLQSQDAKNYIKSLPKVQKKD
FASILKYANPLAVNLLEKMLVLDAEKRVTAAEALMHPYFEPIHDPEEETEAEKYDDTFDN
MDLPLDEWKRITYKEILNFKPPQTSESKETAV
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagccgctcgccagccccggcggctgctcagcggtcgatggaagaagtggtaccaaa
gtggccattaagaaattgtaccgcccgtttcagtctgaactcttcgccaagcgagcttac
cgagagctgcgcctcctgaaacacatgaagcacgaaaacgtcattggaatattggatgtg
ttcacaccagatgtaacactggagaagtttaatgacttctaccttgtcatgccgtttatg
ggaacagacttgagtaagataatgaagcatgaaaaactaactgaagaccgaatccagttt
ctggtatatcagatgttgaaaggcttgaagtatattcactcatcaggcataattcacagg
gatctaaagcctggaaacttggcagtaaacgaagactgtgaattgaagattctggatttt
ggattggcaaggcatacagacagcgagatgactggttacgtggttacaaggtggtacaga
gccccagaggtcatacttaactggatgcattatacgcaaacagttgacatctggtctgtg
ggctgtataatggctgagatgataacagggaggcctctgttcaaaggaaacgatcatctg
gaccaactcacagaaataatgaaaataacaggtacaccaactcaagattttgttcaaaaa
ctgcagagtcaagatgcaaaaaactatatcaaaagcctcccaaaagtccagaaaaaagat
tttgcatccatcttgaagtatgcgaatcctttggctgtaaaccttttggagaagatgctg
gtgctggatgcagagaagcgagtcacagcagctgaggctttgatgcatccttactttgaa
ccaattcacgatcctgaggaagaaactgaagctgagaaatatgacgacacatttgataac
atggatcttccgctagatgagtggaagcgcattacatataaagagatactgaacttcaag
ccaccacagacatcagagtcaaaggagacagcggtgtaa

KEGG   Nipponia nippon (crested ibis): 104013235
Entry
104013235         CDS       T05756                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104013235 (MAPK14)
   04370 VEGF signaling pathway
    104013235 (MAPK14)
   04068 FoxO signaling pathway
    104013235 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104013235 (MAPK14)
   04218 Cellular senescence
    104013235 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104013235 (MAPK14)
   04621 NOD-like receptor signaling pathway
    104013235 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    104013235 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    104013235 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104013235 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    104013235 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104013235 (MAPK14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104013235 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104013235 (MAPK14)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104013235 (MAPK14)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104013235 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 104013235
NCBI-ProteinID: XP_009463992
LinkDB
Position
Unknown
AA seq 328 aa
MALTVTRSAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP
AKSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLK
PSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCI
MAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEARNYIQSLSYMPKMNFEN
VFIGANPLAVDLLEKMLVLDTDKRITAAEALAHAYFAQYHDPDDEPVADPYDQSFESREL
EIEEWKSLTYDEVISFVPPPLDQEEMES
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcgttgactgtgactcgttctgcctttgacacaaaaacggggttgcgtgtggctgta
aagaagctgtcccgaccatttcagtctatcatccatgccaaaaggacctaccgagagcta
cggctacttaagcacatgaaacacgaaaatgtgattggtttgttggatgtgttcacccct
gccaagtcactagaagaattcaatgatgtgtacttggtgacacaccttatgggagcagat
ctgaacaacattgtgaaatgccagaaactcacagatgaccacgtgcagttccttatatac
caaattcttcgaggactgaagtacatccattcagctgacataatacacagggatttaaaa
cctagtaacctagctgtaaatgaagactgtgagctaaagatcctggattttggcttggcc
cgacacacagatgatgagatgaccgggtatgtggctacccggtggtacagggctcctgag
atcatgctgaactggatgcattacaaccagacagttgatatttggtcagtgggatgcatt
atggctgaactgttgactggaagaacattgttccctggtacagaccatattaaccagctt
cagcagatcatgcgtctgacgggaacaccccctgcatatctcattaacaggatgcccagc
catgaggcaagaaactacattcagtctttgtcttacatgccgaaaatgaactttgaaaat
gtgtttattggtgccaatccactagctgtggacttgctagagaagatgttggtactggat
acagacaaacgaattactgcagcagaagcgttggctcatgcctactttgctcagtatcat
gacccagatgatgaaccagtggcagacccctatgaccagtcttttgaaagcagagaactt
gagattgaagaatggaaaagcctgacttatgatgaagtaatcagctttgtgccaccaccg
cttgaccaagaggagatggagtcctga

DBGET integrated database retrieval system