KEGG   Nipponia nippon (crested ibis): 104010364
Entry
104010364         CDS       T05756                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010364 (NRAS)
   04012 ErbB signaling pathway
    104010364 (NRAS)
   04370 VEGF signaling pathway
    104010364 (NRAS)
   04371 Apelin signaling pathway
    104010364 (NRAS)
   04068 FoxO signaling pathway
    104010364 (NRAS)
   04150 mTOR signaling pathway
    104010364 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104010364 (NRAS)
   04137 Mitophagy - animal
    104010364 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    104010364 (NRAS)
   04218 Cellular senescence
    104010364 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104010364 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104010364 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104010364 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104010364 (NRAS)
   04912 GnRH signaling pathway
    104010364 (NRAS)
   04916 Melanogenesis
    104010364 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104010364 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nni04147]
    104010364 (NRAS)
   04031 GTP-binding proteins [BR:nni04031]
    104010364 (NRAS)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    104010364 (NRAS)
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104010364 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   104010364 (NRAS)
  Exosomal proteins of breast cancer cells
   104010364 (NRAS)
  Exosomal proteins of colorectal cancer cells
   104010364 (NRAS)
GTP-binding proteins [BR:nni04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104010364 (NRAS)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase FeoB_N TPP_enzyme_M
Other DBs
NCBI-GeneID: 104010364
NCBI-ProteinID: XP_009460749
LinkDB
Position
Unknown
AA seq 154 aa
LQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL
YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDA
FYTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM
NT seq 465 nt   +upstreamnt  +downstreamnt
ttgcaggattcctatagaaagcaggttgttatcgatggagagacgtgcttgttagacatc
ctggacactgcgggacaggaggagtacagcgccatgcgtgaccagtacatgcggactggg
gaaggattcctctgtgtgtttgccattaacaacagtaaatcgtttgctgatattaacctt
tacagagagcagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttggg
aataagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaa
agctatggaatccccttcatagagacgtctgctaaaacaagacagggtgtggaagatgct
ttttacacactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaa
gatgggaatcaaggctgtatgggattgtcttgcattgtgatgtga

KEGG   Nipponia nippon (crested ibis): 104010969
Entry
104010969         CDS       T05756                                 

Gene name
RRAS2
Definition
(RefSeq) ras-related protein R-Ras2
  KO
K07830  Ras-related protein R-Ras2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04218  Cellular senescence
nni04371  Apelin signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010969 (RRAS2)
   04371 Apelin signaling pathway
    104010969 (RRAS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104010969 (RRAS2)
   04137 Mitophagy - animal
    104010969 (RRAS2)
  09143 Cell growth and death
   04218 Cellular senescence
    104010969 (RRAS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104010969 (RRAS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104010969 (RRAS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nni04147]
    104010969 (RRAS2)
   04031 GTP-binding proteins [BR:nni04031]
    104010969 (RRAS2)
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104010969 (RRAS2)
  Exosomal proteins of bladder cancer cells
   104010969 (RRAS2)
GTP-binding proteins [BR:nni04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104010969 (RRAS2)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf ATP_bind_1
Other DBs
NCBI-GeneID: 104010969
NCBI-ProteinID: XP_009461436
LinkDB
Position
Unknown
AA seq 199 aa
MSKCCQACSVTSYSSVLYVLVSHTNLFYFLQSYFVTDYDPTIEDSYTKQCVIDERAARLD
ILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILV
GNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPP
SPEPTRKEKDKKGCHCVIF
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtccaaatgctgtcaagcatgcagtgtaacatcttactcgagtgtcctgtatgtgctt
gtctcacacacaaacttgttttattttctgcagtcctattttgttacggattatgatcca
acgattgaagactcctacaccaagcaatgtgtgatagatgaaagagctgcgcgcttggac
attctggatacagcaggacaagaagaatttggagccatgcgtgaacagtacatgaggaca
ggggagggttttctgcttgttttctcagtcactgatagaggaagttttgaagaaatctat
aagtttcagcgacaaattcttagagtgaaagaccgtgatgagtttcctatgattctagtt
gggaataaagcagatctggaccaccaaagacaggtgacacaagaggagggtcagcagcta
gcacgacaacttaaagtaacatacatggaagcctcagcaaaaatcagattgaatgtagac
caagcttttcatgaacttgtcagagttataaggaaatttcaagaacaagagtgccctcct
tcaccagagccaacacggaaagaaaaagacaagaaaggctgccattgtgttattttctga

KEGG   Nipponia nippon (crested ibis): 104012697
Entry
104012697         CDS       T05756                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104012697 (KRAS)
   04012 ErbB signaling pathway
    104012697 (KRAS)
   04370 VEGF signaling pathway
    104012697 (KRAS)
   04371 Apelin signaling pathway
    104012697 (KRAS)
   04068 FoxO signaling pathway
    104012697 (KRAS)
   04150 mTOR signaling pathway
    104012697 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104012697 (KRAS)
   04137 Mitophagy - animal
    104012697 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    104012697 (KRAS)
   04218 Cellular senescence
    104012697 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104012697 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104012697 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104012697 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104012697 (KRAS)
   04912 GnRH signaling pathway
    104012697 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    104012697 (KRAS)
   04916 Melanogenesis
    104012697 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104012697 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:nni04031]
    104012697 (KRAS)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    104012697 (KRAS)
GTP-binding proteins [BR:nni04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104012697 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha ATP_bind_1 FeoB_N DUF3781
Other DBs
NCBI-GeneID: 104012697
NCBI-ProteinID: XP_009463363
LinkDB
Position
Unknown
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC
VKIKKCLVMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKTKTKCIIM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacagaatataaacttgttgtcgttggagctggtggtgtaggcaagagtgccttgaca
atacagctaattcagaatcactttgtggatgaatatgaccctacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattcttgatacagcaggt
caagaagaatacagtgcaatgagggaccaatatatgagaacaggggaaggcttcctgtgt
gtatttgctataaacaatacaaagtcttttgaagatattcaccattatagggaacaaata
aagagagttaaagactctgaagatgtcccaatggtgctagtaggaaacaaatgtgatttg
ccttccagaacagtagatacaaaacaagctcaggatttagcaagaagttatggaattcct
ttcattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
cgagagattcgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc
gtgaaaattaaaaaatgccttgtaatgggtgttgatgatgccttctatacattagttcga
gaaatcagaaaacacaaagagaagatgagcaaagatggtaaaaagaagaaaaagaagaca
aagacaaagtgtataattatgtaa

KEGG   Nipponia nippon (crested ibis): 104017304
Entry
104017304         CDS       T05756                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04144  Endocytosis
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04540  Gap junction
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104017304 (HRAS)
   04012 ErbB signaling pathway
    104017304 (HRAS)
   04370 VEGF signaling pathway
    104017304 (HRAS)
   04371 Apelin signaling pathway
    104017304 (HRAS)
   04068 FoxO signaling pathway
    104017304 (HRAS)
   04150 mTOR signaling pathway
    104017304 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104017304 (HRAS)
   04140 Autophagy - animal
    104017304 (HRAS)
   04137 Mitophagy - animal
    104017304 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    104017304 (HRAS)
   04218 Cellular senescence
    104017304 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104017304 (HRAS)
   04540 Gap junction
    104017304 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104017304 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104017304 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104017304 (HRAS)
   04912 GnRH signaling pathway
    104017304 (HRAS)
   04916 Melanogenesis
    104017304 (HRAS)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104017304 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104017304 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nni04147]
    104017304 (HRAS)
   04031 GTP-binding proteins [BR:nni04031]
    104017304 (HRAS)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    104017304 (HRAS)
Exosome [BR:nni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104017304 (HRAS)
  Exosomal proteins of colorectal cancer cells
   104017304 (HRAS)
GTP-binding proteins [BR:nni04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104017304 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25 AAA_16
Other DBs
NCBI-GeneID: 104017304
NCBI-ProteinID: XP_009468598
UniProt: A0A091VI53
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
CMNCKCVIS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgaca
atacagctcattcagaaccatttcgttgatgagtacgaccccacgatagaggattcctac
agaaagcaagtcgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg
caagaggagtacagtgccatgagagaccagtacatgagaacgggagaaggattcctctgt
gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc
aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta
ccagcccggacagtggagactcggcaagcgcaggacctggcccggagttacgggatcccc
tacatagagacgtctgccaaaaccagacagggcgttgaagatgccttctacacgttggtg
cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc
tgcatgaactgtaaatgtgtgatatcgtga

KEGG   Nipponia nippon (crested ibis): 104018970
Entry
104018970         CDS       T05756                                 

Gene name
MRAS
Definition
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04218  Cellular senescence
nni04371  Apelin signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104018970 (MRAS)
   04371 Apelin signaling pathway
    104018970 (MRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104018970 (MRAS)
   04137 Mitophagy - animal
    104018970 (MRAS)
  09143 Cell growth and death
   04218 Cellular senescence
    104018970 (MRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104018970 (MRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104018970 (MRAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:nni04031]
    104018970 (MRAS)
GTP-binding proteins [BR:nni04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104018970 (MRAS)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 104018970
NCBI-ProteinID: XP_009470463
UniProt: A0A091VPY4
LinkDB
Position
Unknown
AA seq 208 aa
MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP
MILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP
EKSQKKKKKTKWRGDRATGSHKLQCVIL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctacaagtgccgttcccagcgaaaacctccccacatacaagctggtggtggttgga
gacggaggcgtggggaagagcgctctcaccattcagtttttccagaagatttttgtgccg
gactacgacccaactattgaagactcctacctgaagcacacagaaatagacgggcaatgg
gcaattcttgatgttctcgatactgcaggccaagaggagttcagcgcaatgcgggagcag
tacatgaggaccggagatggtttccttatagtctactcggtgacagacaaggctagcttc
gagcacgtggaccggttccaccagctgatcctcagagtcaaggacagagagtcctttcca
atgattttggtggcgaacaaagttgatctaatgcatttacggaaaattacaagagaacag
ggaagagaaatggcaacaaaacataatattccctatatagaaactagcgccaaggaccca
cctctaaacgttgacaaggccttccatgatctggtgagggtaataaggcaacagatccca
gagaaaagccagaaaaagaagaaaaagaccaaatggcgaggggacagagccacgggctcc
cacaaactccagtgtgtgattttgtga

DBGET integrated database retrieval system