Nipponia nippon (crested ibis): 104010364 Help Entry 104010364         CDS       T05756                                  Gene name NRAS Definition (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04012   ErbB signaling pathway nni04068   FoxO signaling pathway nni04137   Mitophagy - animal nni04140   Autophagy - animal nni04150   mTOR signaling pathway nni04210   Apoptosis nni04218   Cellular senescence nni04370   VEGF signaling pathway nni04371   Apelin signaling pathway nni04540   Gap junction nni04625   C-type lectin receptor signaling pathway nni04810   Regulation of actin cytoskeleton nni04910   Insulin signaling pathway nni04912   GnRH signaling pathway nni04916   Melanogenesis Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104010364 (NRAS)    04012 ErbB signaling pathway     104010364 (NRAS)    04370 VEGF signaling pathway     104010364 (NRAS)    04371 Apelin signaling pathway     104010364 (NRAS)    04068 FoxO signaling pathway     104010364 (NRAS)    04150 mTOR signaling pathway     104010364 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104010364 (NRAS)    04137 Mitophagy - animal     104010364 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104010364 (NRAS)    04218 Cellular senescence     104010364 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104010364 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104010364 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104010364 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104010364 (NRAS)    04912 GnRH signaling pathway     104010364 (NRAS)    04916 Melanogenesis     104010364 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nni04131]     104010364 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nni04147]     104010364 (NRAS)    04031 GTP-binding proteins [BR:nni04031]     104010364 (NRAS) Membrane trafficking [BR:nni04131]  Endocytosis   Macropinocytosis    Ras GTPases     104010364 (NRAS) Exosome [BR:nni04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104010364 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104010364 (NRAS)   Exosomal proteins of breast cancer cells    104010364 (NRAS)   Exosomal proteins of colorectal cancer cells    104010364 (NRAS) GTP-binding proteins [BR:nni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104010364 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase FeoB_N TPP_enzyme_M Motif Other DBs NCBI-GeneID:  104010364 NCBI-ProteinID:  XP_009460749 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search LQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDA FYTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 465 nt NT seq  +upstreamnt  +downstreamnt ttgcaggattcctatagaaagcaggttgttatcgatggagagacgtgcttgttagacatc ctggacactgcgggacaggaggagtacagcgccatgcgtgaccagtacatgcggactggg gaaggattcctctgtgtgtttgccattaacaacagtaaatcgtttgctgatattaacctt tacagagagcagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttggg aataagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaa agctatggaatccccttcatagagacgtctgctaaaacaagacagggtgtggaagatgct ttttacacactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaa gatgggaatcaaggctgtatgggattgtcttgcattgtgatgtga

Nipponia nippon (crested ibis): 104010969 Help Entry 104010969         CDS       T05756                                  Gene name RRAS2 Definition (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04137   Mitophagy - animal nni04140   Autophagy - animal nni04218   Cellular senescence nni04371   Apelin signaling pathway nni04625   C-type lectin receptor signaling pathway nni04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104010969 (RRAS2)    04371 Apelin signaling pathway     104010969 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104010969 (RRAS2)    04137 Mitophagy - animal     104010969 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     104010969 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104010969 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104010969 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nni04147]     104010969 (RRAS2)    04031 GTP-binding proteins [BR:nni04031]     104010969 (RRAS2) Exosome [BR:nni04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104010969 (RRAS2)   Exosomal proteins of bladder cancer cells    104010969 (RRAS2) GTP-binding proteins [BR:nni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104010969 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 Motif Other DBs NCBI-GeneID:  104010969 NCBI-ProteinID:  XP_009461436 LinkDB All DBs Position Unknown AA seq 199 aa AA seqDB search MSKCCQACSVTSYSSVLYVLVSHTNLFYFLQSYFVTDYDPTIEDSYTKQCVIDERAARLD ILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILV GNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPP SPEPTRKEKDKKGCHCVIF NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgtccaaatgctgtcaagcatgcagtgtaacatcttactcgagtgtcctgtatgtgctt gtctcacacacaaacttgttttattttctgcagtcctattttgttacggattatgatcca acgattgaagactcctacaccaagcaatgtgtgatagatgaaagagctgcgcgcttggac attctggatacagcaggacaagaagaatttggagccatgcgtgaacagtacatgaggaca ggggagggttttctgcttgttttctcagtcactgatagaggaagttttgaagaaatctat aagtttcagcgacaaattcttagagtgaaagaccgtgatgagtttcctatgattctagtt gggaataaagcagatctggaccaccaaagacaggtgacacaagaggagggtcagcagcta gcacgacaacttaaagtaacatacatggaagcctcagcaaaaatcagattgaatgtagac caagcttttcatgaacttgtcagagttataaggaaatttcaagaacaagagtgccctcct tcaccagagccaacacggaaagaaaaagacaagaaaggctgccattgtgttattttctga

Nipponia nippon (crested ibis): 104012697 Help Entry 104012697         CDS       T05756                                  Gene name KRAS Definition (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04012   ErbB signaling pathway nni04068   FoxO signaling pathway nni04137   Mitophagy - animal nni04140   Autophagy - animal nni04150   mTOR signaling pathway nni04210   Apoptosis nni04218   Cellular senescence nni04370   VEGF signaling pathway nni04371   Apelin signaling pathway nni04540   Gap junction nni04625   C-type lectin receptor signaling pathway nni04810   Regulation of actin cytoskeleton nni04910   Insulin signaling pathway nni04912   GnRH signaling pathway nni04914   Progesterone-mediated oocyte maturation nni04916   Melanogenesis Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104012697 (KRAS)    04012 ErbB signaling pathway     104012697 (KRAS)    04370 VEGF signaling pathway     104012697 (KRAS)    04371 Apelin signaling pathway     104012697 (KRAS)    04068 FoxO signaling pathway     104012697 (KRAS)    04150 mTOR signaling pathway     104012697 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104012697 (KRAS)    04137 Mitophagy - animal     104012697 (KRAS)   09143 Cell growth and death    04210 Apoptosis     104012697 (KRAS)    04218 Cellular senescence     104012697 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104012697 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104012697 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104012697 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104012697 (KRAS)    04912 GnRH signaling pathway     104012697 (KRAS)    04914 Progesterone-mediated oocyte maturation     104012697 (KRAS)    04916 Melanogenesis     104012697 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nni04131]     104012697 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:nni04031]     104012697 (KRAS) Membrane trafficking [BR:nni04131]  Endocytosis   Macropinocytosis    Ras GTPases     104012697 (KRAS) GTP-binding proteins [BR:nni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104012697 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha ATP_bind_1 FeoB_N DUF3781 Motif Other DBs NCBI-GeneID:  104012697 NCBI-ProteinID:  XP_009463363 LinkDB All DBs Position Unknown AA seq 227 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC VKIKKCLVMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKTKTKCIIM NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaacttgttgtcgttggagctggtggtgtaggcaagagtgccttgaca atacagctaattcagaatcactttgtggatgaatatgaccctacaatagaggattcctac aggaagcaagtagtaattgatggagaaacctgtctcttggatattcttgatacagcaggt caagaagaatacagtgcaatgagggaccaatatatgagaacaggggaaggcttcctgtgt gtatttgctataaacaatacaaagtcttttgaagatattcaccattatagggaacaaata aagagagttaaagactctgaagatgtcccaatggtgctagtaggaaacaaatgtgatttg ccttccagaacagtagatacaaaacaagctcaggatttagcaagaagttatggaattcct ttcattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg cgagagattcgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc gtgaaaattaaaaaatgccttgtaatgggtgttgatgatgccttctatacattagttcga gaaatcagaaaacacaaagagaagatgagcaaagatggtaaaaagaagaaaaagaagaca aagacaaagtgtataattatgtaa

Nipponia nippon (crested ibis): 104017304 Help Entry 104017304         CDS       T05756                                  Gene name HRAS Definition (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04012   ErbB signaling pathway nni04068   FoxO signaling pathway nni04137   Mitophagy - animal nni04140   Autophagy - animal nni04144   Endocytosis nni04150   mTOR signaling pathway nni04210   Apoptosis nni04218   Cellular senescence nni04370   VEGF signaling pathway nni04371   Apelin signaling pathway nni04510   Focal adhesion nni04540   Gap junction nni04625   C-type lectin receptor signaling pathway nni04810   Regulation of actin cytoskeleton nni04910   Insulin signaling pathway nni04912   GnRH signaling pathway nni04916   Melanogenesis nni05132   Salmonella infection Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104017304 (HRAS)    04012 ErbB signaling pathway     104017304 (HRAS)    04370 VEGF signaling pathway     104017304 (HRAS)    04371 Apelin signaling pathway     104017304 (HRAS)    04068 FoxO signaling pathway     104017304 (HRAS)    04150 mTOR signaling pathway     104017304 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104017304 (HRAS)    04140 Autophagy - animal     104017304 (HRAS)    04137 Mitophagy - animal     104017304 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104017304 (HRAS)    04218 Cellular senescence     104017304 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104017304 (HRAS)    04540 Gap junction     104017304 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104017304 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104017304 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104017304 (HRAS)    04912 GnRH signaling pathway     104017304 (HRAS)    04916 Melanogenesis     104017304 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104017304 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nni04131]     104017304 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nni04147]     104017304 (HRAS)    04031 GTP-binding proteins [BR:nni04031]     104017304 (HRAS) Membrane trafficking [BR:nni04131]  Endocytosis   Macropinocytosis    Ras GTPases     104017304 (HRAS) Exosome [BR:nni04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104017304 (HRAS)   Exosomal proteins of colorectal cancer cells    104017304 (HRAS) GTP-binding proteins [BR:nni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104017304 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25 AAA_16 Motif Other DBs NCBI-GeneID:  104017304 NCBI-ProteinID:  XP_009468598 UniProt:  A0A091VI53 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgaca atacagctcattcagaaccatttcgttgatgagtacgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggagagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggagaaggattcctctgt gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagactcggcaagcgcaggacctggcccggagttacgggatcccc tacatagagacgtctgccaaaaccagacagggcgttgaagatgccttctacacgttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

Nipponia nippon (crested ibis): 104018970 Help Entry 104018970         CDS       T05756                                  Gene name MRAS Definition (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism nni  Nipponia nippon (crested ibis) Pathway nni04010   MAPK signaling pathway nni04137   Mitophagy - animal nni04140   Autophagy - animal nni04218   Cellular senescence nni04371   Apelin signaling pathway nni04625   C-type lectin receptor signaling pathway nni04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:nni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104018970 (MRAS)    04371 Apelin signaling pathway     104018970 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104018970 (MRAS)    04137 Mitophagy - animal     104018970 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     104018970 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104018970 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104018970 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:nni04031]     104018970 (MRAS) GTP-binding proteins [BR:nni04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104018970 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  104018970 NCBI-ProteinID:  XP_009470463 UniProt:  A0A091VPY4 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGSHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctacaagtgccgttcccagcgaaaacctccccacatacaagctggtggtggttgga gacggaggcgtggggaagagcgctctcaccattcagtttttccagaagatttttgtgccg gactacgacccaactattgaagactcctacctgaagcacacagaaatagacgggcaatgg gcaattcttgatgttctcgatactgcaggccaagaggagttcagcgcaatgcgggagcag tacatgaggaccggagatggtttccttatagtctactcggtgacagacaaggctagcttc gagcacgtggaccggttccaccagctgatcctcagagtcaaggacagagagtcctttcca atgattttggtggcgaacaaagttgatctaatgcatttacggaaaattacaagagaacag ggaagagaaatggcaacaaaacataatattccctatatagaaactagcgccaaggaccca cctctaaacgttgacaaggccttccatgatctggtgagggtaataaggcaacagatccca gagaaaagccagaaaaagaagaaaaagaccaaatggcgaggggacagagccacgggctcc cacaaactccagtgtgtgattttgtga

DBGET integrated database retrieval system