KEGG   Nipponia nippon (crested ibis): 104010373
Entry
104010373         CDS       T05756                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104010373 (CDKN1A)
   04068 FoxO signaling pathway
    104010373 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104010373 (CDKN1A)
   04115 p53 signaling pathway
    104010373 (CDKN1A)
   04218 Cellular senescence
    104010373 (CDKN1A)
SSDB
Motif
Pfam: CDI TetR_C_8
Other DBs
NCBI-GeneID: 104010373
NCBI-ProteinID: XP_009460757
LinkDB
Position
Unknown
AA seq 155 aa
MPLSQSRAGQVPCSSKVCRNLFGPVDHDQLQNDFQDLLRQHIEEAQQRWNFNFETETPLE
GHFKWERVFLDEQPPQEVHSLIKVTGSESRSSLVHKVPSKDHPGRICPEGSQQSSEVCRA
GSPHSLKRGQTTIKDFYSSKRRVIPDKPKPDKPKP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgcccctgtctcagagcagggccgggcaggtgccatgcagcagcaaggtgtgcaggaac
ctctttggccccgtggaccacgaccagctccagaatgactttcaggacctgttgaggcaa
cacatagaagaagctcagcagcgctggaacttcaactttgagacggagactcccttggaa
ggacacttcaagtgggagagggtcttcctggatgagcagccaccccaggaggtccacagc
ctgatcaaggtcactggcagtgagagcaggagctccttggtccacaaggtcccctccaag
gaccatcctggcaggatttgccctgaggggtctcagcagagctcggaggtttgcagggct
ggttccccacacagcttgaaacgtgggcagaccaccatcaaagacttctatagctccaag
cggagggtcatccccgacaagcccaagcctgacaagcccaagccatga

DBGET integrated database retrieval system