KEGG   Nipponia nippon (crested ibis): 104010425Help
Entry
104010425         CDS       T05756                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104010425 (CACNA1E)
   04020 Calcium signaling pathway
    104010425 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104010425 (CACNA1E)
Ion channels [BR:nni04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104010425 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 104010425
NCBI-ProteinID: XP_009460817
LinkDB All DBs
Position
Unknown
AA seq 2297 aa AA seqDB search
MARFGEAVAGRLGSGDGGSDQNRSRQGPPAPAGGTPGAFKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRNRT
DTMNRDSSDEHCVDISSVGNPLSHSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEGINKDEPSLINPHASIFRRKKLGDGVALEKCSEEQGGKGERPPAE
GPEQLASGANPSSGEDRRSPSPRAKRDKESWHQKSCHGNCEPGEQDGAGGSIEDRARMRQ
SQRRSRHRRARMEGKEPAGALGSRSASQEMGLEEASPTEGVQDGDRHGDTASVEALIQGE
PEASGEPIRTNGVPAGEAELVGTAEEGSPSQVALEPTRAKMGSLTEQDCSSLDTSEQALL
EASRTVSRSEPDLSSITPNTEKATESTTIMIDVHDSAVVQISNKTDGEASPLKEAETKED
EEEIEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASS
IALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDF
IVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLK
NVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCRE
WKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYF
VVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTF
QYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVL
KIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLL
RQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFR
SFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFI
FFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEM
LTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGAD
WQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQR
QQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIF
QLACMDPAHGQFQEHQSLEPEVREFQRVQPSNHGSCLPVDTQDHAVSGRASSMPRLTVDP
QVVTDTSSMRRSFSTIRDKRTNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNAD
SGHRSDGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERQRESRSPSEGRS
QTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHTGDASPPPE
ESEGGSPLLSSTLDPNAAGLTESSSSPAGKQSRQSTPQRYISEPYLALHDDSHASDCGEE
ETLTFEAAVATSLGRSNTIGSPPPPARPTPTGPPPPLRHSWQMPNGHYRRRRRGAGQGVM
CGASIDVLSDTEEDDKC
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atggctcgctttggggaggcggtggctggcaggctgggctctggagatgggggctctgac
cagaaccggagccggcaaggacctcctgctcctgcgggagggaccccaggagccttcaag
caaaccaaagcgcagagagcccggactatggctctgtacaaccccatccctgtccggcag
aactgcttcaccgtcaatagatcgcttttcctctttggggaagagaacatagtcaggaaa
tatgccaagaagcttatcgactggcctccctttgagtacatgatcctggcgaccatcatt
gccaactgcattgtgctggccctcgagcagcacctccccgaggatgacaagacgcccatg
tcacggagattagagaagacagagccctacttcatcgggattttctgctttgaggctggg
attaagatcgtggctctggggtttgttttccacaagggctcgtacctgcgcaacggctgg
aatgtcatggacttcatcgtggtcctcagcggcatcctcgccaccgctgggacacacttc
aacacccacgtggacctgcggacactgagggctgtgcgcgtgctcagaccgctgaagctt
gtctcaggcattcccagcctgcagattgtgctgaaatccatcatgaaggccatggtgcct
ctcctccagatcggcttgctgctctttttcgctatcctcatgtttgccatcattggcctg
gagttttacagcgggaagctgcaccgagcctgctacacaaacaattcaggtgaactagag
gagctggaccccccccatccgtgcggggtgcagggttgccccccaggctacgagtgccgg
gagtggatcggtcccaatgatgggatcacgcagttcgacaacatcctctttgctgtgttg
accgtcttccagtgcatcaccatggaagggtggaccacagtcctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcattggatccttc
tttgtcctcaaccttgtcctgggagtgctgtcgggggagtttgccaaagagcgtgagcga
gtggagaaccgccgagccttcatgaagctgcggcgccagcagcagatcgagcgggagctc
aacggctaccgggcctggatagacaaagcggaggaagtcatgctggctgaagagaacaaa
aattctgggacctcagccttagaagtgctcaggagagccaccatcaaaaggaaccggacg
gacaccatgaaccgtgactcgagcgacgagcactgcgttgatatctcctccgtgggtaac
cccttgagtcactctggcctcaaaggtgccagagtggatggtgcctcctacttacggcac
aaggagcgactcctgcgcatctccgttcgccacatggtgaaatcccaggtcttctactgg
attgtcttgagcctggtggctctcaacactgcctgcgtggccatcgtccatcacaaccag
ccagcctggctcacccacttcctctactatgcagagttcctgtttcttgggctctttctt
ctggagatgtccttaaagatgtatgggatggggccacgcctttacttccattcttctttc
aactgctttgactgtggggtcacggttggaagcatctttgaagtggtttgggctatcttc
agaccaggaacctcttttgggatcagtgtcctacgagcccttcgtctcctgcgaatattt
aaaataaccaagtactgggcatccctgaggaatttggtggtctcactgatgagctccatg
aagtctattatcagtctgctcttcctcctcttcctcttcattgtagtctttgccctgctg
ggaatgcagctgtttggaggcaggtttaacttcattgatgggacgccatcagccaacttt
gacactttccctgcagccatcatgacggtgttccagatcctgacgggtgaggactggaat
gaggtgatgtacaacggcatccgctcccagggaggcgttcgctcaggcatgtggtcctcc
atctatttcatcgtcctcaccttgtttggaaactatactctgctgaacgtattcttggct
attgcagtggacaacctagccaatgctcaggagctcaccaaggatgagcaggaggaagag
gaagcctttaaccagaagcacgcccttcagaaagccaaagaagtcagccccatgtccgcc
ccaaacatgcctgctattgaaagagacaggcgaaggagacaccacatgtcgatgtgggag
ccgcgcagcagccacctgcgggagcgtcgccggcggcaccacatgtcggtgtgggagcag
cgcaccagccagctgcgccggcacatgcagatgtccagccaggagggcatcaacaaggat
gagccgtccctcattaacccccacgccagcatcttccgcaggaagaaactgggggatggc
gtcgccctggagaaatgctccgaggagcagggtggcaagggtgagcggccaccggctgag
ggccctgagcagctggcctccggggccaaccccagcagtggtgaggacaggaggagccca
tcgccccgggccaagcgagacaaggagtcatggcaccagaaatcgtgccatggaaactgt
gagccgggtgagcaggacggggcaggaggcagcatcgaggacagggccaggatgaggcag
agccagcggcgcagccggcaccgcagagcccggatggaggggaaggagccagctggtgcc
ctggggagccgctcggccagccaggagatgggtctggaggaggccagccccacggaaggg
gtgcaggatggggaccggcatggggacacagcctcagtggaggcgctgattcagggggag
ccagaggcaagcggagagcccatcaggacaaatggggtccctgccggcgaagccgagctg
gtcgggaccgccgaggaggggagcccctcgcaagtggcactggagcccacacgggcaaaa
atgggcagcctgacagagcaggactgcagcagcctggacaccagtgagcaagcactgctg
gaggccagccgcactgtcagccggagcgagcccgacctctcttccatcacccccaatacc
gagaaggccacggagagcaccaccatcatgatcgatgtccacgactccgctgtggtacag
attagcaacaagacagatggtgaagccagccccttaaaggaggccgagaccaaagaggat
gaggaggagatagagaagaagaagcgaaagaaggagaaaagcgagacgggcaaagcgatg
gtgccgcacagctccatgttcatcttcagcaccaccaacccggtgcggagggcttgccac
tacatcgtgaacctgcgctacttcgagatgtgcatcctcctggtgatcgccgccagcagc
attgccctcgcggcggaggatcccgtcctcaccaactccgaccgcaacaaagtcctgaga
tatttcgactacgtcttcaccggtgtcttcacctttgagatggttatcaagatgatcgat
cagggcttgatcctgcaggacggctcctacttccgagacctctggaacatcctggatttc
atcgtggtggtgggagcactggtggcttttgccttggcgaatgctttggggaccaacaag
ggccgggatatcaagaccatcaagtctctccgtgtgttacgggtcttgaggcccctgaaa
accatcaagcgactgcccaagctgaaggccgtctttgactgcgtggtgacttccctcaag
aacgtcttcaacatcctcattgtctacaagctcttcatgttcatctttgctgtcattgcc
gtccagcttttcaaggggaagtttttctactgcactgacagctctaaggacacggagaag
gactgcatagggaactacgtggaccacgagaagaacaagatggaagtgaagtgccgggaa
tggaaacgccatgagtttcactacgacaatatcatctgggctttgctcaccctgttcaca
gtctccaccggcgagggttggcctcaggtgctgcagcattcagtggatgtgacggaggag
gaccgcgggcctagccgcagcaaccgcatggagatgtccattttttatgtcgtctatttt
gtggtcttccctttcttctttgtcaacatttttgtggctctcatcatcattacgttccaa
gagcaaggagacaaaatgatggaggagtgcagtctggagaagaatgagagggcctgtatt
gactttgccatcagcgccaagcccctcacacggtacatgccccagaaccggcacaccttc
cagtaccgggtctggcactttgtggtctccccatccttcgagtacaccatcatggccatg
attgcattgaacaccgtggtgctgatgatgaagtactactctgctccatacacctacgag
ctggccctgaagtacctgaacatcgcattcaccatggtgttctccttggagtgcgtcctc
aagatcatcgctttcggcttcctgaattatttccgggacacctggaacatctttgacttc
atcactgtcatcggcagcattacggagatcatcctgacggacaccaagctggtgaacacc
agcagcttcaacatgagtttcctgaagctcttccgggctgctcggctcatcaagctgctg
cgccagggttacaccatccgcatcctgctctggacgttcgtacagtccttcaaggccctc
ccctacgtctgcctcttgatcgccatgcttttcttcatctatgcgatcattgggatgcag
gtttttggcaatatcaaactagatgaggaaagccacattaaccggcacaacaacttccgc
agcttcctgggctccctcatgctcctcttcaggagtgccacaggagaggcatggcaggag
atcatgctgtcctgcctggagggcaaaggctgtgagccggacacgacagcgacgtctggg
cagaacgagaacgagcgctgtggcactgacctggcctacgtttactttgtctccttcatc
ttcttctgctctttcctgatgctcaacctgttcgtggcggtcatcatggacaattttgaa
tacctgactcgggattcctccatcctgggaccgcaccatctagatgagtttgtccggatc
tgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtatgaaatg
ctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctat
aagagactggttctgatgaacatgcccgtggctgaggacatgacggtccattttacctcc
accttgatggcgctgatacgcacggccttagacatcaaaattgccaaaggtggtgcagat
tggcagcagttagactctgagcttcagaaggagatcctgaccatttggcctcacctatcc
cagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgactgttggcaaa
atatatgcagccatgatgatcatggattactacaagcagagcaaagcgaagaagcagcgg
cagcagctggaggagcagaaaaatgcccccatgttccagcgcatggagccatcctccttg
ccacaggaaatcatctcaaatgcgaaggctctgccttacctccagcaggacaccctctcg
ggcctgagcagccggagcgggttcccctcactgagcccgctctcgccacaggagatcttc
cagctggcgtgcatggatccagcccacgggcagttccaggagcaccagtctctggagcca
gaggttagggagtttcaaagagtgcagccctctaaccatggcagctgccttcctgtggac
actcaggaccacgctgtctctgggagggcctcctccatgcctcgtctcactgtggatccc
caggtggtgacggacaccagctcgatgcggcgatcattttctaccatccgggacaagcgc
accaacagctcctggctggatgaattctccatggagcgcagcagtgacaacacctacaag
tcccgccggcgcagctaccactcctcgctccagctctctgcccggcgcctcaacgctgac
tcgggccaccggtccgacgggcatcgctcaggcggcagggagcggggccgatccaaagag
cgcaagcacttgctgtcccctgatatctcccgctgcaattctgaggagaggagtccccag
gcacatgacgagtcgccggagcggcagcgcgaatcccggtcacccagcgagggcaggtcg
cagacacccaacaggcagggaacaggctccctgagtgaaagctccatcccctccatctcg
gacaccagcactccccggcgaggccgccgccagctcccgccagtgccccccaagccacgt
cccctcctgtcctacgcctccatgctgcggcacactggagacgcctcgccgcctcctgag
gagagtgagggggggtccccactcctctcctccaccctggatcccaatgccgccggcctg
accgagtcttccagctccccagcggggaagcagagccgacagtccaccccgcaacgttat
atctcggagccctacttggccctgcatgacgactcgcacgcctcagactgcggtgaggag
gagacgctcaccttcgaggcggccgtcgccaccagcctcggccgctccaacaccatcggc
tccccccccccccccgcccgccccacccccacgggcccgcccccgccgctgcggcacagc
tggcagatgcccaacgggcactaccggcggcggaggcgaggggcagggcagggcgtgatg
tgcggggccagcatcgacgtgctcagcgacaccgaggaagacgacaagtgctag

DBGET integrated database retrieval system