KEGG   Nipponia nippon (crested ibis): 104010776Help
Entry
104010776         CDS       T05756                                 

Gene name
HDAC10
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104010776 (HDAC10)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104010776 (HDAC10)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     104010776 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl MAP65_ASE1
Motif
Other DBs
NCBI-GeneID: 104010776
NCBI-ProteinID: XP_009461218
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MASGTALIYDEEMTTHKLLWSDPVCDIEVPERLSSSYEQLKCYHLVERCVLVPAREGSEE
EILLVHSPEHLEVAKSTQTMNEEELKRVSGNYDAFFFHPNTYRCARLAVGATLQLVDAVM
SGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYVFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGRGFNINLPWNKIGMGNSDY
LAAFFHVLLPMAFEFDPELVLVSSGYDSGIGDPEGQMDATPEVFAHLTHFLMQLANGKLC
VILEGGYHLKSLSESVCMTVKTLLGDPVPQITGEMAPCLSAVESIQNVRAAHKPYWKWLM
YEVPPIKTATTTDSKGSAHLLPVPIHLVKEMDKTEIKALVGDFYADLVKEDRTLLSLGSM
MAILDKILKKEVCNGIAESPTAAVSVAVALRHCVHFGFQRVLCVFVGDMQIIPNTEDGKI
LIIHICEKEQAGKTGSKHYISLNWKEDAEGNDFFSAVLGFILPVAYSYQPNLTVIAVGPN
RSLGINEICLLFALLQGLAESRILAVIEETEINLMQSVAKALVGASTPHFGVYVPPTQEK
VNKIKILRDQFQGMQEWKMLQCSVKDGI
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcgctgatttatgatgaggagatgaccactcataaactactttgg
agtgatcctgtttgtgatattgaagtgccagaaaggctgtcatcctcctatgagcagctt
aaatgttaccatctcgtggaaagatgtgtcctcgtgcctgccagagaaggaagcgaggag
gagatcctgttggttcacagtccagaacacttggaagtggcgaaaagcactcagacaatg
aatgaagaggaactgaaaagagtctctggaaattatgatgcttttttctttcatccgaac
acttaccgctgtgccagactagcagtaggagcaactttgcagctggtggacgctgtgatg
tcaggaaaagtgtgcaatggaatggcactagtaagacctccaggtcaccacagccagaga
aatgcagctaatgggttctgtttgttcaacaatgttgctattgcagcagaatatgcaaaa
ctgaaatatggtctacagagaatcctaattgttgactgggatgtgcaccacgggcaagga
actcaatatgtatttgaagaggatccaagtgttttgtatttttcttggcatcgctatgaa
catcaggaattctggccatcactcaaagaatctgattatgatgctgtgggtctgggaaaa
ggaagaggttttaacataaatttgccttggaataagattgggatgggaaattcagattat
cttgctgcgtttttccatgtgttgcttccaatggcttttgagtttgatcctgaactggtt
cttgtctcctctggctatgattctggaattggagaccctgaaggtcagatggatgccact
cccgaggtttttgcgcaccttacccatttcctgatgcagttagctaatggaaagctgtgt
gtcatcctagagggtggataccacttaaagtcattgtctgaatcagtctgcatgactgta
aaaactttgcttggagatcctgtacctcaaataactggagagatggcaccttgcctaagt
gctgttgaatctattcaaaatgtgagagcagcacataaaccctactggaaatggttgatg
tatgaagtgcctcccatcaaaacagcaacaacaactgactctaaaggttcagcacatttg
ctccctgtgcccattcatttggtgaaggaaatggacaaaactgaaataaaagctcttgtc
ggtgacttttatgcagaccttgtaaaagaggacagaactttgctctctcttggcagtatg
atggccatcctagataaaatacttaagaaggaggtatgcaatggaattgcagaatcaccc
acagctgctgtttctgttgctgttgcgctaagacattgtgttcattttggatttcaaaga
gtgctttgtgtatttgttggagacatgcaaatcataccgaacacggaagatggaaaaata
ctcataatacatatttgtgagaaagaacaggctggaaagaccggctccaaacactacatt
tctctaaactggaaagaggatgctgaaggaaatgacttcttttctgctgtacttggattc
attcttcctgtagcatacagttatcaaccaaacttgacagtaattgctgttggaccaaac
aggagtcttggaataaatgaaatttgtctgctttttgctttactacaaggattagctgag
tctcgaattcttgcagtgatcgaggagacagagataaatttaatgcaaagtgtagccaaa
gcattagtgggtgcttctacacctcactttggagtttatgtacctcctacccaagaaaaa
gtaaataaaataaaaatactaagggaccagtttcaggggatgcaggaatggaaaatgctt
cagtgctcagtgaaggatgggatttga

DBGET integrated database retrieval system