KEGG   Nipponia nippon (crested ibis): 104010840
Entry
104010840         CDS       T05756                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04310  Wnt signaling pathway
nni04350  TGF-beta signaling pathway
nni04371  Apelin signaling pathway
nni04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104010840 (SMAD4)
   04350 TGF-beta signaling pathway
    104010840 (SMAD4)
   04371 Apelin signaling pathway
    104010840 (SMAD4)
   04068 FoxO signaling pathway
    104010840 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104010840 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104010840 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 104010840
NCBI-ProteinID: XP_009461289
LinkDB
Position
Unknown
AA seq 551 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSSAPSSMLVKDEYVHDYEGQPSLSSAEGHSV
QTIQHPPSNRASTEPYSTPAMLAPTEASTTSTTNFPNIPVASTSQPTSILTGSHSDGLLQ
IASGPQPGTQQNGFTAQPATYHHNSTTTWTGSRTAAYTPTIPHHQNGHLQHHPPMHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDR
FCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRA
PGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPA
ISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLH
TMPIADPQPLD
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattactaacacgccaacaagtaatgatgcttgtctgagcattgtt
cacagcttgatgtgccatcgacaaggtggagagagtgaaacttttgcaaaacgcgcaatt
gaaagtttagttaaaaagctaaaggagaaaaaagatgaattggattctttgattacagct
ataaccacaaatggagctcatcctagcaagtgtgttacaatacagagaacgctggatggg
aggcttcaggtggctggtcgcaagggattccctcatgtgatttacgctcgtctttggagg
tggcctgatcttcataaaaatgaactcaagcatgttaaatattgtcagtatgcttttgac
ttaaaatgtgacagtgtctgtgtaaatccttaccattatgagcgtgtagtatcgcctggc
atcgatctctcaggactgacactacagagttctgctccatcaagcatgttggtgaaagac
gaatacgttcatgactacgaggggcagccgtcattgtcttctgccgaaggccattcagtc
caaaccatccagcatccaccaagtaacagggcatctacagagccttatagcaccccagcc
atgttagctcctactgaggctagcactaccagcaccactaattttcccaacattcctgtg
gcttcaacaagtcaacctaccagtatattgacaggtagccatagtgatggactcttacag
attgcttcagggcctcagccaggaactcagcagaatgggtttacagctcagccagctact
taccatcacaatagtactacaacttggactggaagtcggacggcagcctacacacccacc
atacctcaccaccagaatggccatcttcagcatcatccacctatgcatcctggacattac
tggccagttcacaatgaactcgcattccagcctcctatatcaaatcatcctgctccagaa
tattggtgttcgatcgcgtattttgaaatggacgtgcaagttggggaaacgtttaaggtc
ccttcgagctgtccaattgttactgttgatggatacgtggatccttctggaggagaccgt
ttttgcctgggccagctttccaacgtgcatagaacagaagccatcgagagagcaaggttg
cacatagggaaaggggtgcagctggagtgcaaaggagaaggcgacgtgtgggtgagatgc
ctcagcgaccacgcggtcttcgttcagagttactacctggacagagaagcagggcgtgcg
ccgggggatgctgttcacaagatttacccaagtgcatatataaaggtgtttgatttacgc
cagtgtcatcgtcagatgcaacagcaggctgccactgcccaagctgctgccgctgctcaa
gctgcagcagtagccggaaacatccctggaccaggatcagtaggtggaatagccccagcc
attagtttgtcagccgctgctggaattggtgtagatgaccttcgccgcttatgcatactc
aggatgagttttgtaaaaggttggggacctgattacccaagacagagcatcaaagagaca
ccgtgctggattgaaattcacttacaccgtgccctccagcttctagatgaagtacttcat
accatgcctattgcagacccacaacctttagactga

KEGG   Nipponia nippon (crested ibis): 104018277
Entry
104018277         CDS       T05756                                 

Gene name
SNAPIN
Definition
(RefSeq) SNARE-associated protein Snapin
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04310  Wnt signaling pathway
nni04350  TGF-beta signaling pathway
nni04371  Apelin signaling pathway
nni04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104018277 (SNAPIN)
   04350 TGF-beta signaling pathway
    104018277 (SNAPIN)
   04371 Apelin signaling pathway
    104018277 (SNAPIN)
   04068 FoxO signaling pathway
    104018277 (SNAPIN)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104018277 (SNAPIN)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104018277 (SNAPIN)
SSDB
Motif
Pfam: MH2 MH1 Snapin_Pallidin DUF1955
Other DBs
NCBI-GeneID: 104018277
NCBI-ProteinID: XP_009469676
LinkDB
Position
Unknown
AA seq 456 aa
MSLGAPTSSDACLSIVHSLMCHRQGGENETFAKRAIESLVKKLKEKKDELDSLIAAITTN
GAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLKYD
SVCVNPYHYERVVAPAIGEPVPAPPLGGSQPTPPPQPSSRSHPQPPLHHPNHYWPPHHSS
GPYQQPVSTHPGPEFWCSIAYFEMDVQVGEIFKVPSSCPVVVVDGYVDPSGGDRFCLGQL
SNVHRTDASERARLHIGKGVQLECRGEGDVWMRCLSDHAVFVQSYYLDREAGRAPGDAVH
KIYPGAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAGPGNIPEGAGVGLGLGSRVLCWP
PSRPLRRESQVELREHIDSLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQN
AQERLRRLNHSVAKETVRRRAMLEAAGGYPQGLPGK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtccctcggcgcgcccacgagcagcgacgcctgcctgagcatcgtgcacagcctgatg
tgccaccggcagggcggggagaacgagaccttcgccaagcgggccatcgagagcctggtc
aagaagctcaaggagaaaaaggacgagctcgactcgctcatcgccgccatcaccaccaac
ggcgcccaccccagcaagtgcgtcaccatccagcgcaccttggacgggcggctccaggtg
gccggcaggaaggggttcccccacgtcatctacgcccggctctggcgctggcccgaccta
cacaaaaacgagctgaaacacgtcaaattctgccaattcgccttcgacctcaagtacgac
agcgtctgcgtcaacccctaccactacgagcgcgtggtggcccccgccatcggtgagcca
gtcccagcgccacccttgggggggtcgcagcccacccccccgccgcagcccagcagccgg
agccacccgcagcccccgctccaccaccccaaccactactggcccccacaccatagctcc
gggccgtaccagcaaccggtgtccacccaccccgggccagagttttggtgctccatcgcc
tacttcgagatggacgtgcaggtgggggagatcttcaaggtgccgtccagttgccccgtg
gtcgtcgtggacggttacgtggacccttcagggggggaccgcttctgcctggggcagctc
tccaacgtacaccgcaccgacgccagcgagcgggcccggctgcacatcgggaagggcgtg
cagctggagtgccggggcgagggcgacgtctggatgcggtgcctgagcgaccacgccgtc
ttcgtgcagagctactacctggaccgggaggccgggagagcccctggcgacgccgtgcac
aagatctatcccggcgcctacatcaaggtgtttgacctgcgccagtgccaccgccagatg
cagcagcaagcagccacggcccaggctgcggccgccgctcaggctgccgccgggcccggc
aacatcccggagggagcaggggtgggtttggggctggggtcgagggttttgtgctggcca
ccgagccgtcccctccgcagggagagccaggtggagctgcgggagcacatcgacagcctg
gccacggagctctgccgcatcaatgaggaccagaaagtggcgctggaccttgacccctac
gtgaagaagctgctgaacgcccggcgcagggtggtgctggtcaacaacatcctgcagaac
gcccaggaacggctgcggaggctgaaccacagcgtggccaaggagacggtacggaggagg
gctatgctggaggcggcaggtggctacccccagggcctgcccggcaagtga

DBGET integrated database retrieval system