KEGG   Nipponia nippon (crested ibis): 104011004
Entry
104011004         CDS       T05756                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04120  Ubiquitin mediated proteolysis
nni04144  Endocytosis
nni04218  Cellular senescence
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104011004 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104011004 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104011004 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    104011004 (MDM2)
   04115 p53 signaling pathway
    104011004 (MDM2)
   04218 Cellular senescence
    104011004 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104011004 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104011004 (MDM2)
   04121 Ubiquitin system [BR:nni04121]
    104011004 (MDM2)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104011004 (MDM2)
Membrane trafficking [BR:nni04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104011004 (MDM2)
Ubiquitin system [BR:nni04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    104011004 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 104011004
NCBI-ProteinID: XP_009461478
LinkDB
Position
Unknown
AA seq 484 aa
MCNTKMSSLTDASSVTTSEQEALVKPKPLLLKLLKLAGAEKDTFTMKEVIFYLGQYIMSK
QLYDEKQQHIVHCANDLLGDLFGVTSFSVKEHRRLYSMISRNLIAISQQDSTLADTPEDD
GRFQLEEENVVKESMQELEEKQTSSNVTARPTTSSRRRTHSESEENSSDDLHTDRRKRHK
SDSISLTFDESLSWCVVSGLCRERSNSSDSTDSLSIPDLDASSLSENSDWFDHSSVSDQF
SVEFEVESIYSEDYSHNEEGQELTDEDDEVYQLTIYQDEDSDADSFDEDPEISLADYWKC
PECSEMNPPLPRHCHRCWALREDWLPDEKSDKLVKGKLESSFPLESEEGFDVPDCKKAKM
TEDKEPAVEENEDKAVQTSESQESEDYSQPSTSSSMFCSSQEDYKEPERREMQDKEESTE
SSLPVTSIEPCVICQSRPKNGCIVHGKTGHLMSCFTCARKLKKRNKPCPVCRQPIQMIVL
TYFS
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtgcaataccaagatgtcctcccttacggatgcctcttctgtcaccacttcggagcaa
gaggcgctggttaaaccaaagccgctgttgttgaagttgttaaagttagctggtgcagaa
aaggacacttttactatgaaggaggtaatattctatcttggacaatatattatgtctaaa
caattatatgatgaaaaacagcaacatattgtacactgtgcaaatgatctcctgggggat
ttatttggagtaacaagcttttcagtaaaagaacacaggagactgtattcaatgatttcc
agaaatctgatagcgatcagtcaacaagactctacgcttgctgacacacctgaggatgat
ggcagatttcagcttgaagaagaaaatgttgtaaaggaatctatgcaagagttagaagag
aagcagacttcatcaaacgtgactgcccgaccaacgacatcttctaggaggagaacgcac
agtgaatctgaagaaaattcttcagatgatctgcatactgacagaagaaaacgacacaag
tcagacagcatttcgttgacatttgatgaaagtctctcatggtgtgtagtcagtggtctg
tgccgtgaaagaagcaatagcagtgattcaacagattctctttccattcctgatcttgat
gccagttcattaagtgaaaactctgattggtttgaccacagttctgtttcagaccagttc
agtgtagagtttgaagttgagtctatttattcagaagattatagccataatgaagaagga
caggagctcacagatgaagatgatgaggtgtatcagctgactatttaccaagatgaggat
agtgatgctgattcatttgatgaagatccagagatctctctagctgattactggaagtgt
cctgaatgtagtgaaatgaatcctccgctaccacgccattgccacagatgctgggccctt
cgtgaggactggcttccggatgaaaagagtgataaactggtaaagggcaaattagaaagt
tccttccccctggagtctgaagaaggttttgatgttcctgactgcaagaaagcgaaaatg
actgaagataaagaaccagctgtagaggagaatgaggataaagcagtacaaacttccgag
tcgcaggaaagtgaagattattctcagccatcgacatccagcagcatgttttgtagcagt
caggaagactacaaggaacctgagaggagagaaatgcaagacaaagaggaaagcacggaa
tccagtctgcctgttaccagcatagagccctgtgtcatatgtcagagcagacctaaaaat
ggctgcatagtacatggcaaaacgggacacctcatgtcatgctttacgtgcgcaagaaaa
cttaagaagaggaacaaaccctgcccggtgtgcaggcagcccatacaaatgattgtacta
acttattttagttag

DBGET integrated database retrieval system