KEGG   Nipponia nippon (crested ibis): 104011186Help
Entry
104011186         CDS       T05756                                 

Gene name
SDHB
Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00020  Citrate cycle (TCA cycle)
nni00190  Oxidative phosphorylation
nni01100  Metabolic pathways
nni01200  Carbon metabolism
Module
nni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nni_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104011186 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104011186 (SDHB)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104011186 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2 Fer4_18
Motif
Other DBs
NCBI-GeneID: 104011186
NCBI-ProteinID: XP_009461675
LinkDB All DBs
Position
Unknown
AA seq 294 aa AA seqDB search
MAAAVVGVSLRRGVPLRFLRAGPHPKEPKGSSAVVXIQMCRGAQTAAAAAPRIKKFAIYR
WDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCHSGICGSCAMNIA
GGNTLACIKRIDPDLNKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQG
KEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDY
TEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKATAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtgggagtctccttgagacgcggcgtccccctgcggttcctgcgg
gccgggccccaccccaaggaacctaagggctcttctgctgtcgtttgaatacagatgtgt
cggggagcgcagacagcagctgcagcagcgccccgtatcaagaagtttgccatctacaga
tgggatcctgataagcctggggacaagccccgcatgcagacgtatgaagtggatttgaat
aaatgtgggcctatggtgctcgatgctctgatcaagattaaaaacgagttggactccact
ctgaccttccgcagatcgtgtcactcaggcatctgcggctcttgtgctatgaacattgct
ggtggaaacacgctggcctgtatcaaaagaattgaccccgatctcaacaaggtcactaaa
atctaccctctcccccacatgtatgtggtgaaggaccttgttccagacttgagtaacttc
tatgcacagtacaaatccatcgagccttacctgaagaagaaggatgagtcgaaacagggc
aaggagcagtacctgcagtccatagaagaccgtcagaaactggacggactctacgagtgc
atcctgtgtgcctgctgcagcaccagttgtcccagttactggtggaacggggacaagtac
ttgggtcctgcggtactgatgcaggcctatcgctggatgattgactccagagatgactac
acagaggaacgcctggcacagcttcaagacccgttttctctctaccgttgtcacactatc
atgaattgcacaaggacttgcccgaagggtttgaaccccggcaaagcaattgctgagatc
aagaagatgatggcaacttacaaagagaaggcaacggctgcgtaa

DBGET integrated database retrieval system