KEGG   Nipponia nippon (crested ibis): 104011220Help
Entry
104011220         CDS       T05756                                 

Gene name
UBR4
Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nni04121]
    104011220 (UBR4)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     104011220 (UBR4)
Ubiquitin system [BR:nni04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    104011220 (UBR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 zf-UBR AP3D1
Motif
Other DBs
NCBI-GeneID: 104011220
NCBI-ProteinID: XP_009461714
LinkDB All DBs
Position
Unknown
AA seq 5155 aa AA seqDB search
MVWLSAGNGRIGPLNYLAGLREEFERKVSLMFSYLLRESEILHHDKQYEPFYSSFVALST
HYITTVCGLIPRNQLQSVAAACKVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSR
LDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPVSPELRQKEVQMNFLNQLTSVFN
PRVSSSPSVTPETQVEGESEDQASTDQTSAAKTKSIFIAQNVASLQELGGSEKLLRVCLN
LPYFLRYINRFQDAVSANSFFIMPATVADATAVRNGFHSLVIDVTMALDTLSLPVLEPLT
PTRLQDVTVLALSCLYAGVSVATCMAILHVGSTQQVRTGSTSSKEEDYENDAATIVQKCL
EIYEMIGQAISNSRRAGGEHYQNFQLLGAWCLLNSLFLILNLSPTALADKGKEKDPLAAL
RVRDIIARTKEGVGSPKLGPGKGHQGFGVLSVVLANHAIKLLSSLFQDLQVEALHKGWES
DGPPAVLDIMAQSTSIQRIQRLIDSVPLTNLLLTLLSTSYRKACVLQRQRKGSMSSDASA
STDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETISPSKEKVAPPPPPPPPPLESSPR
VKSPNKQTAGENGNILASRKDPELFLSLASNILNFITSSMLNSRNNFIRNYLSVSLSEQH
MATLASIIKEVDKDGLKGTSDEEFAAALYHFNHSLVTSDLQSPALQNTLLQQLGVAPFSE
GPWPLYIHPQSLSVLSRLLLIWQHKATAQGDPDVPECLKVWERFVGTLKQNALQGTLPSD
TEDLNVEHLQLLLLIFHNFSERGRRSIMMLCIQTIVELTVNMDTQQCSVPLIVARLLLVF
DYLLHQYSKAPMYLFEQVQYNWLTPPIGWVSGSQDSSRRTSVPLYHAFKEVEENWTKHCS
SDTVPQPRFYCILSLEASEDDLNRLDSTVCEVLFSRTMKYDELYAALTSLLAAGSQFDTL
RRKENKNVTALEACALQYYFLILWRILGILPPSKNYMNQLAMNTPEMSECDILHTLRWSS
RLRIASYVTWIKDHLTKQGMKADHAASLIELASSKCSSVKYDVEIAEEYFARQISSFCGV
DCTTILQLHEVPSLQSIYTLDAAISKIQVSLDEHFSKLAAETDPHKSSEITKNLLPATLQ
LIDTYATFTRSYLLRSLSEEGSTENKPSEEKLRGYAAVLAIGSSRCKSNTLGPTLVQNLP
SAVQTLCESWNNIHTNEFPNIGSWRNAFANDTIPAESYISAVQAAHLGTLCSQSLPLAAS
LKHTLLSLVRLTGDLVVWSDDLNPPQVIHSLLPLLLETSTESVAEISSNSLERILGPAES
DEFLARVYEKLITGCYNILAHHSDPNSGLDESILEECLQHLEKQLESSQARKAMEEFFSE
SGELVQIMMATANENLSAKFCNRVLKFFTKLFQLTEKSPNPSLLRLCGSLAQLACVEPVR
LQAWLTRMTTSPPKDSDQLDVVQENRQLLQLLTTYIVRENSQVGEGVCTVLLSTLIPMAT
EMLANGDGTGFPELMVVMATLASAGQGAGHLQLHGAAVDWLGRCKKYLSQKNVVEKMNAN
VMQGKHVTILECTCHIVSYLADVTNALSQTSGQGPSHLSVDGEERAIEVDSDWVEELAVE
EEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHE
ISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQSEPRVPESVIRHASTSP
AEKAKVTISEGKGPDEEKPKKSSLCRNVEGCREELQSQANFSFAPLVLEMLNFLMDAIQI
NFQQASAMGSSSRAQQALNELHTLDKSVEMTDQLMVPTLGSQEGAFENVRMNYSGDQGQT
IRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKITVLQLSALLKQADSSKRKLTLTR
LASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGNFIIK
AVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFLLPSSKIRDVTFLFNEEGKNIIVIM
SSAGYIYTQLMEEASSAQHGPFYVTNVLEVNHEDLKDSNGQVAGGGVSVYYSHVLQMLFF
SYCQGKSFAATISRANLEVQRLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTT
GVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMA
NVENTSYWLQPSLQPSSVISIMKPVRKRKAAAITTRTSSQVNFPIDFFEHNQQLTDVEFG
GNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEVTNNNSTMVMTGMRIQIGTQAIERA
PSYLEIFGRTMQLNMTRARWFDFPFTREEALQADKKLTIFIGASVDPAGVTMMDSIKIYG
KTKEQFGWPDEPPEDFPSASVSNVCPPNLNQGNGTGDTESATPAAASGTVLERLVVSSLE
ALESCFAVGPVNEKEKNKVAAQELATMLLSMPAPSSVQQQTKSLLASLHTSRSAYHNHKD
QALLSKAIQYLSSSTKEGKDLDPEVFQRLVITARSIAIMRPNNLVHYTESKLPQLETENE
EGQEAQKQAEGDGCTFITQLVNHFWKLHASKPKNAFLAPACLPGLTHVEATVNALVDIIH
GYCTCELDCIHTASKIYMQMLLCPDPAVSFSCKQALIRVLRPRNKRRHVTLPSSPRSNTP
MGDKDDDDDDDAEDKLQSSGIANGEHIRQESQEQSEVDHGDFEMVSESMVLETSENVNNG
NPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQGSSSSALGLQSLGLSG
QAPSSSSLDAGTLSDTTASAPASDDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSV
AGEHSVSGRSSAYGDTTAEGHPAGPGSVSSSTGAISTTTGQQEGDGSEGEGEAEGDVHTS
NRLHMVRLMLLERLLQNLPQLRNVGGVRAIPYMQVILMLTTDLDGDDEKDKGALDNLLSQ
LIAELCMDKKDVSKKNERSPVNEVHLVVMRLLSVFMSRTKSGSKSSICESSSLISSATAA
ALLSSGAVDYCLHVLKSLLEYWKSQQNDEEPVATSQLLKPHTTSSPPDMSPFFLRQYVKG
HAADVFEAYTQLLTEMVLRLPYQIKKIADTNSRIPPPIFDHSWFYFLSEYLMIQQTPFVR
RQVRKLLLFICGSKDKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYD
TLISLMEHLKACAEIATQRTVNWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCAL
CGSKVLSVASSSGSSSTSSTSAPAASGSGQPATQSKSSTKKSKKEEKEKEREGESSGSQE
DQLCTALVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLALHIYRNSNKSQQELLL
DLMWSIWPELPAYGRKAAQFVDLLGYFSLKTQQTEKKLKEYSQKAVEILRTQNHILTNHP
NSNIYNTLSGLVEFDGYYLESDPCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGS
HTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVK
IDLPLPIVASNLMIEFADFYENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCR
SINYDEKDPFLCNACGFCKYARFDFMLYAKPCCAVDPIENEEDRKKAVTNINTLLDKADR
VYHQLMGHRPQLENLLCKVNEAAPEKPQDESGSSGGISSTSASVNRYILQLAQEYCGDCK
NSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTTVQPTFTASQYRALSVLGCGHTS
STKCYGCASAVTEHCITLLRALATNSAIRHILVSQGLIRELFDYNLRRGAATMREEVRQL
MCLLTRDNPEATQQMNDLIIGKVSAALKGHWANPDLASSLQYEMLLLTDSISKEDSCWEL
RLRCALSLFLMAVNIKTPVVVENITLMCLRILQKLIKPPAPTSKKNKDVPVDALTTVKPY
SNEIHAQAQLWLKRDPKASYEAWKKCLPARGIDANGKSPSKAELHQLYLSEKYVWKWKQF
MSRRGKRTCPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIPSRKQQVLDLLTS
YLDELSIAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYIGSLITKEIARLLALEEATL
STDLQQGYALKSLTGLLSSFVEVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQ
DMLLEMLEDMTTGTESETKAFMAVCIETAKRYSLDDYRTPVFIFERLCSIIYPEENEVTE
FFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMEL
LVNNKIISLDLPVAEVYKKVWCPTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEED
EEEVYKMAGVMAQCGGLECMLNRLTGIKDFKQGRHLLTVLLKLFSYCVKVKINRQQLVKP
EMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLT
GDKDQLVMLLDQINSTFVRSNLSVLQGLLRIIPYLSFGEMEKMQILVDRFKPYCNFDKYD
EEHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDAD
IWKKFLSRPALPFILRLLRGLATQHPATQVLIGTDSITNLHKLEQVSSDEGIGTLAENLL
EALREHPEVNKKIDAARKETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQME
ELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEEFENKPRKQQGYSTVSHFNIVHY
DCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTG
QREPTYQLNVHDIKLLFLRFAMEQSFSVDTGGGGRESNIHLIPYIIHTVLYVLNTTRATS
REEKNLQSFMEHPKEKWVESAYEVDGPHYYTVLALHISPPEKWKAMRVEILKRLLITSHA
RVVSPGGASRLADKTVKEYATYRSGLLFWALVDLIYNMFKKVPTSNTEGGWSYSLAEFIR
HNDMPIHEAADKALKTFQEEFMPVETFSEFLDVAGLLSEINDPDNFLKDLLNSIP
NT seq 15468 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggctgtcggcgggaaacggccgcatcgggccactgaattacctcgcagggctg
cgggaggaatttgaacgtaaagtctctctcatgttctcttatttattacgcgagtctgaa
atcctgcaccatgacaaacagtatgagcctttttactcttccttcgttgcactttctacg
cattacatcactactgtgtgtggtctaataccgagaaaccagttgcaatcagtggcagct
gcttgtaaagtcctgattgaattctccctgctgcgtcttgagaacccagatgaagcatgt
gctgtttcacagaaacacctcattctactgataaaggggctgtgcacgggctgcagccgc
ctagatcgaactgaaattattaccttcacagcaatgatgaagtcggccaagctccctcag
actgtcaaaaccctctctgatgtagaggaccagaaggagctggcctcgccggtgagccca
gaactaagacagaaagaagtgcagatgaacttcctcaatcagttgacatcagtgtttaac
cctagggtttcatcatcaccatctgtcacgccagagacacaggtggaaggagagagcgag
gatcaagcttccacagatcagacctctgcagcaaagacaaaaagcatattcatcgctcag
aatgtagccagcctgcaagaacttggtggctctgaaaaactgctgagggtgtgcctgaac
ctcccatactttttgcgatacataaatcgatttcaggacgcagtgtcggccaactcattt
tttattatgccagccacagttgcagatgccactgctgttcgcaatgggtttcattcgctg
gtaatagatgtgaccatggcactggatacgctgtctctgcctgtactggagcccctgaca
cccacgcgtctccaagatgtgactgttcttgctctcagctgtctctatgcaggtgtgagc
gtggcaacttgcatggccatcctgcacgtgggtagcactcaacaggtacgaactgggtca
acaagctccaaagaagaagattatgaaaatgatgctgctactattgtacagaaatgtctt
gaaatctatgaaatgattggacaagccatcagcaattcacgccgtgcggggggtgagcat
tatcagaacttccagctgctcggggcttggtgtttgctaaacagcctcttcctcatcttg
aacctcagccctacggccttggctgataagggaaaggagaaagatccattggctgctctt
cgcgtcagagacattattgcccgtactaaggagggcgttgggtctcccaaactaggacct
gggaaagggcatcaagggtttggtgttctgtcagtggtgctagcaaatcatgctatcaaa
ttgctgtcatcgctctttcaagatctgcaagtggaggcattgcacaagggctgggagagt
gatggtccgccagcagtgctggatatcatggctcaaagcacatccatccagagaattcag
cggctgatagattctgtgccgctcactaatttgctgctgactttgctatctacttcctac
agaaaggcttgtgtcttgcagcgtcagaggaagggctccatgagcagcgacgcaagtgcc
tccactgattcgaatacttactatgaggatgattttagcagcactgaggaggacagcagc
caagatgacgacagtgaaccaatcctcgggcaatggtttgaagagacaatctccccaagc
aaagagaaagtggccccaccaccaccccctccaccgccacctttggagagctcgcctaga
gtgaaaagccctaacaaacagactgctggagagaacgggaacatcctggccagccgcaaa
gatccagaattgtttttgagcctagcttcaaacattttgaactttatcacttcttctatg
ctgaactccaggaataacttcattcgcaactacctgagtgtctctctttcggagcagcac
atggctacactggctagcatcatcaaagaagtggataaggacgggcttaaaggcacgtca
gatgaggagtttgctgctgcgctgtatcacttcaaccattccttggtgacctcagatctt
cagtcccctgccttgcagaacacacttcttcagcaactgggagttgcccctttttctgaa
ggtccgtggcctctctacattcatcctcaaagtctgtcggtgctctcacgacttctcctg
atttggcagcataaagccactgcccagggagatcctgacgttccagaatgccttaaagtt
tgggaaaggtttgtgggcacattgaagcaaaacgccttgcaggggactcttcccagtgac
acagaggatctgaatgttgaacatctccagctgctgctgcttatttttcacaatttctcc
gagaggggccgcagatctatcatgatgctgtgtatccagacaattgtggagctgacagtg
aacatggatacccagcagtgttctgtgccacttatcgtggcacgtctgctcttggtattt
gactacctgctccatcagtattccaaggcccccatgtacctatttgaacaggtgcaatat
aattggctgactccacccattggctgggtgagtggatcccaggacagtagcagacgaaca
tctgtcccactttatcatgcgtttaaagaagtggaagaaaactggaccaaacactgttca
tcagacacagttccacagcccagattctactgcatcctatctctggaagcttctgaagat
gatctgaaccgtctggatagcacggtttgtgaggtccttttctctaggaccatgaagtat
gacgagctctacgcagccctgacttcattacttgcagctgggtcacagtttgatacactc
aggaggaaagagaacaaaaatgtcactgcactggaagcctgtgcacttcagtactacttc
ttgatactgtggcggatactagggattttgcctccatccaaaaactacatgaatcaattg
gctatgaacacaccagagatgagtgaatgtgatattttacacacgttgcgctggtcttct
cgtctgcgcatcgcgtcttacgtcacgtggatcaaggatcaccttaccaagcagggcatg
aaagctgaccatgctgcttctctcattgaattggcctccagcaagtgcagctcagtgaag
tacgatgtggaaatagcagaggaatactttgctcgacagatatcttctttctgtggtgtt
gattgcacaactattctccaactgcacgaagttcctagtttacagtccatttacaccctt
gatgctgcaatttccaagattcaggtttctctagatgagcacttttccaagctagctgca
gaaactgatccacacaagtcttcagagataaccaagaacctcctgcctgctacgctacag
cttattgacacttacgctacgtttaccagatcttacttgctccggagcctctctgaagag
ggctccactgagaacaaaccctctgaagagaagctacgaggttatgctgctgtcctggcc
attggatccagccgttgcaaatctaatactctaggtccaacacttgttcagaacttgcca
tcagctgtgcagactttatgtgaatcatggaacaacattcatacaaatgagtttccaaac
attggctcatggcgcaacgcctttgcgaatgacacgatccctgcagaaagctacatcagc
gcagttcaggccgcccacctcggtactctctgcagccaaagtctacctcttgcagcttcc
ctaaaacacacccttctctccctggtcagactcactggggatctcgtggtctggtcagat
gatttgaacccgccacaggtgattcattccctattgcccctccttttggagaccagcaca
gagagcgtggcagagataagcagcaactccctagaaaggatcttgggccctgcagaatcg
gatgaattcctggcgcgtgtttatgagaaactgatcacaggatgctataacatactggcc
catcactctgatccaaacagtggcctggatgagtccatcttggaggaatgtttgcagcat
ctggagaaacagctggagagcagccaggcccgaaaagccatggaggaattcttttcagaa
agtggagaactggtccagatcatgatggcgacagccaatgaaaacctctcggcgaagttc
tgcaacagggtgctgaaattcttcaccaagctcttccagctaactgagaagagtcccaac
cccagcctgttgcggctttgtggttctttggctcagctggcttgtgtggagcctgtacgt
ctccaggcctggttaaccaggatgaccacatccccacccaaagattcagatcaactggac
gttgttcaagagaacaggcaactgctgcaactcttgacaacttacattgttcgggaaaac
agccaagtcggagaaggcgtgtgcactgttctgctgagtactctgataccaatggcaaca
gaaatgttggccaatggtgatggcacaggctttccagaactgatggtcgtgatggcaact
ttggctagtgcaggacaaggcgcgggacacctccagcttcatggtgctgctgttgattgg
ctaggcagatgcaagaaatacctgtctcaaaagaatgtggtagaaaaaatgaatgcaaac
gtcatgcaagggaagcatgtgactatcctggagtgtacatgccatattgtctcttacctg
gccgatgtcaccaatgcgctgagccagaccagtggccaaggaccaagtcatctttccgtt
gatggagaggaacgggcgattgaggtggattcagactgggtggaagagttggcagtggag
gaggaggactctcaagctgaggattcggatgaagattctctttgtaataaactctgtacc
ttcaccatcacacagaaggaattcatgaatcaacactggtatcactgtcacacttgcaag
atggttgatggggttggtgtttgcacggtttgtgctaaagtttgtcacaaggatcatgag
atttcttatgccaaatacggatcgttcttctgtgactgtggagccaaggaagatggcagt
tgcctggctttggtgaagagaactcccagcagtggtatgagctctaccatgaaagaatcc
gccttccagagcgagcccagagtgcccgagagtgtcattcgacatgccagcacttctcct
gcagagaaagccaaggtcaccatcagtgaggggaagggccctgacgaagaaaaacccaag
aagagcagcctgtgtagaaacgttgagggctgtcgagaggaattgcagtcccaggccaac
ttctcctttgcacctttggtgctggagatgctgaatttcctgatggatgccattcagata
aacttccagcaagcttcggccatggggagcagcagtcgtgcacagcaagctctcaatgag
ctacatactttggacaagtcagtagaaatgacggatcagttgatggtcccaactcttggc
tctcaagaaggtgcttttgagaacgtccgcatgaactacagcggtgaccagggccagacg
atccggcagctgatcagcgcccacgtgctgaggcgggtggcgatgtgcgtgctgtcgtcc
ccgcatggacgtcggcagcacctggctgtgagtcacgaaaagggcaagattacagtcctt
cagctctcagccttgctcaaacaagcagactccagcaaaagaaaattgacccttactcgc
ctcgcgtccgcacccgttccgtttactgtactgagcctaactggaaatccctgcaaggag
gactacctagccgtgtgtggactgaaagactgccatgtgctaacattcagcagctctgga
tcagtctctgatcatctggtacttcatccccaactagccactgggaatttcatcattaaa
gctgtgtggctgccaggatctcaaacagagcttgctattgtgactgcagactttgtgaag
atttacgatctctctgtagatgccttgagtccaactttctatttccttctaccgagttcc
aaaatcagggatgtcactttccttttcaacgaggaggggaagaacataatagtgatcatg
tcctccgctgggtacatctatacgcagctcatggaagaggcgagcagtgcccagcatgga
ccattctatgtcaccaatgtgcttgaagtcaatcacgaggacctaaaggacagtaatggc
caggtagcaggaggcggtgtgtcagtgtattactcccatgtgctacagatgttgttcttc
agttactgtcaaggcaaatccttcgcagccaccatcagccgggccaatctggaagtgcag
cggctattcccgattaacataaagagttcaaacggtgggagtaagacttcaccggcactg
tgtcagtggtctgaggtgatgaaccatcctggcttggtgtgctgtgttcagcaaaccaca
ggtgtcccactggtggtgatggtgaagccggacacctttctcatccaggagattaaaacc
ctgccagccaaagcaaagattcaggacatggtggccatccgtcacacagcctgcaatgag
cagcagaggaccactatgatcctcctgtgtgaagacggcagcctgaggatctacatggcc
aatgtagagaatacctcctactggctccagccctctctccagcctagcagcgtcatcagc
atcatgaagccagttcgcaagcgcaaggcagctgctattacaactcgcacatccagccaa
gtgaacttccctattgacttctttgaacacaaccagcagctcacagatgtagagtttgga
ggcaacgacctgctgcaggtttacaatgctcagcagatcaagcaccggctcaattccact
ggcatgtatgtggccaacacaaagcctgggggtttcaccattgaagtgacgaacaataac
agcacgatggtgatgacaggcatgcggatccagattggcacacaagcgatagagagagcg
ccctcgtacttggagatctttggccgcaccatgcagctgaacatgaccagggctcgttgg
tttgacttccctttcactcgcgaggaagcattgcaggctgacaaaaaactaaccatcttc
attggggcttccgtggatcctgctggagtcacaatgatggattccataaaaatttatggc
aaaaccaaagagcagtttgggtggcctgatgagccccccgaggatttcccatctgcttca
gtgagcaacgtttgtcccccaaacctgaatcaagggaatggcactggagacacggagtcg
gctacccctgctgctgccagtggcactgtcctggagaggctagtagtgagttctttagaa
gcactggaaagctgctttgctgtaggaccagtcaacgagaaggagaagaataaggtggca
gctcaggaactggctactatgctgctctccatgccagctccttccagtgtccagcagcag
accaagagcctcttggctagcttgcacaccagccgctcagcataccataaccacaaggat
caagcattgttaagtaaagccattcagtatttgagttcctcaaccaaagaaggaaaggac
cttgatcctgaagtgtttcagaggctggtcatcaccgctcgatccattgctattatgaga
cccaacaatctggtccattatacggaatcaaagctgccacagttggaaacagagaatgaa
gaagggcaagaggcccagaaacaggctgaaggagatggctgcacatttattacccagctg
gtcaaccacttctggaagctacatgcatcaaaacccaaaaacgccttccttgcccctgcc
tgcttgccaggtctcactcatgttgaagccacagtcaatgctttggtggatattatccat
ggatactgcacgtgtgaactggattgtatccatacagcatccaagatctatatgcagatg
ttactttgcccggatcctgcagtgagcttttcttgcaaacaagctttgatcagagtgctg
agaccaaggaacaagcggagacatgtcaccttgccatcctcccctcggagcaatactcct
atgggagataaggatgatgatgatgatgacgacgcggaagacaagctgcagagttctggg
atagcaaacggtgagcatatccgacaggaaagccaagagcaaagcgaagttgatcacggg
gacttcgagatggtgtccgaatctatggttctggagacttctgaaaatgtgaataatggg
aatccttctcccctggaggctcttctggctggagcagagggattccctcctatgctggat
attcctccagatgcagatgatgaaacaatggtggaactggctattgccctgagcctgcaa
caagatcagcaagggagcagcagtagtgcacttggacttcagagcttaggactgtctggc
caagcacccagctcttcttctctcgatgccggaacgctctcagatacaacagcatcagct
ccagcgtctgatgatgaaggcagcacagctgcaacagatggctcaactctgcggacttca
cctgcagaccatggtgggagcgtgggctctgagagcggtggcagcgcggtggactccgta
gctggtgagcacagcgtgtctggccgtagtagtgcctatggggacacgacagcggagggc
caccctgctgggccaggcagcgtcagctcaagcacaggcgctatcagcactaccacaggc
cagcaagagggagatggttcagaaggggaaggggaggcagagggagatgtccacaccagc
aacaggctgcatatggtccgactgatgttgctggagaggctgctgcaaaacttacctcag
ctgaggaatgttggaggagtccgggccattccttatatgcaggttattctgatgctcaca
acagacctagatggagatgatgagaaagacaagggtgctttagataaccttctgtcccaa
ctgattgcagaactgtgcatggacaaaaaggatgtgtctaagaaaaacgaacgctctcct
gtgaatgaagtgcacttggtggtaatgaggctgcttagtgtgttcatgtccagaactaag
tcaggatccaagtcttccatttgtgagtcttcctccctcatctctagtgccactgctgct
gcgttgttgagctctggtgctgttgactactgtctgcatgtactgaagtctttgctggag
tactggaaaagccagcagaatgacgaggagcctgtagccaccagccagctcctcaaacct
cacactacttcttctccacctgacatgagcccttttttcctccgccagtatgtgaagggt
catgctgcagatgttttcgaggcctacactcagctcctgacagagatggtgctgcggctg
ccctatcagatcaagaagattgcagacacaaactcccgcatcccacctcccatctttgat
cactcctggttttactttttgtctgagtacctgatgatccagcagaccccattcgtgcgc
cgccaagtccgcaagcttttgctctttatctgtggatcaaaggataaataccgccagctc
agggaccttcacaccttggactctcatgttcgtggaatcaaaaagctcctagaagagcaa
ggtattttcctccgtgccagtgtggtcacagcaagttcaggctcggccctgcagtacgat
acgttgatcagcttgatggaacatttaaaggcttgtgcagagatcgccacacagcgaaca
gtaaactggcagaaattctgcattaaagacgactcggttctctatttcctccttcaagtc
agcttcctggtagatgaaggagtgtcgccagttctcctgcagctgctgtcttgtgctctg
tgtggcagtaaagtgctgtctgtggcttcatcctccggatcatcaagcacctcttccacc
tctgctcctgcagcatcgggctctgggcagccagcaacacagagcaaatcctccactaaa
aagagcaagaaagaagaaaaggaaaaggagcgagagggcgagagttcgggcagtcaggaa
gatcagctgtgtacagctctggtgaaccagctgaacaagtttgctgataaggagaccctc
attcagttcctgcgttgcttcttgctggagtccaactcgtcctccgtgaggtggcaggcc
cactgcctcgcgctccacatctacaggaactcgaacaagtctcagcaagaattactgttg
gatctcatgtggtccatctggccagaacttccagcctacggaagaaaggctgctcagttt
gtagatctcctgggatacttctctctgaaaacacagcagaccgagaaaaagttgaaggaa
tactcccaaaaggctgtggagatcctccggactcaaaaccacattcttaccaaccaccct
aactccaacatttacaacacactgtctgggctggtggaatttgatggctattacctggag
agcgatccttgcctcgtctgcaacaatccagaggtgcccttctgttacatcaagctttcc
tccattaaagtggacacgcggtatactaccacccagcaagtggtgaaactaatcggcagc
cacaccatcagcaaagtgacagtgaagataggagacctgaaacgaaccaaaatggtccga
accatcaacctctattacaacaacaggacggtgcaagccatagtggagctgaaaaacaag
ccggctcgttggcacaaagctaaaaaagtccagctgaccccaggccagacggaggtgaag
attgatttgccgctgcccattgtggcttcgaacctgatgattgaatttgccgatttctat
gagaattaccaggcctccacggagaccctgcagtgcccccgctgcagcgcgtccgtccca
gccaacccgggggtgtgcgggaactgtggcgaaaatgtgtaccagtgccacaagtgcaga
tccattaattacgatgagaaagatcccttcctttgcaatgcctgtgggttctgtaaatat
gctcgctttgacttcatgttgtatgccaagccttgctgtgcagtggatcccatagagaac
gaagaggatcgaaagaaggcagtaacaaatatcaacactctcctggacaaggctgacaga
gtgtatcaccagctaatgggacaccgaccgcagctggaaaaccttctgtgtaaagtgaat
gaggcggctccggaaaagccacaggatgaatctggtagtagcggagggataagttctacc
tcagccagtgtgaatagatacatactccagttagcccaggagtattgcggtgactgcaag
aactctttcgatgaactttccaaaatcatccagaaagtgtttgcctctcgaaaggagctg
ctggaatacgatctccaacagagagaggcagcaacaaagtcctcgcgaaccactgtccag
cccacatttactgccagccagtatcgtgccttgtctgttttaggctgcggccacacatca
tcaacgaaatgctatggctgtgcctcagctgtcactgaacactgcataacgctgctccgg
gctttggcgaccaactctgccatcaggcatatcctcgtgtcccagggccttatccgagag
ctctttgactacaacttgcgccggggcgcagccactatgcgggaggaggtccgtcagctc
atgtgccttctgaccagggacaatccagaggccacgcaacaaatgaatgacttaatcatt
gggaaggtttctgcagctctgaagggacactgggcaaatccagacttggctagcagcctc
cagtatgaaatgttgctgctaacagattccatctcgaaggaagacagctgctgggagctc
cgactacgttgtgctctcagcctctttctgatggcagtgaacattaagactccagtggtt
gttgaaaacatcaccctcatgtgcctgcgcattcttcaaaagctgatcaagccacctgct
ccaaccagcaagaagaacaaggatgtgcctgtggatgctctcaccactgtgaagccttac
agcaatgaaatccatgcacaagctcagctgtggctcaagagggaccccaaagcatcgtat
gaagcttggaaaaagtgcctccctgccagaggtatagatgccaatgggaaatctcccagc
aaagctgagcttcaccagctctacttgtcggaaaaatatgtctggaaatggaaacagttc
atgagtcgccgcgggaagagaacttgccctctggatctcaagctgggacacaacaattgg
ctgcgacaggtgctgtttactcctgccactcaagctgcacggcaagctgcgtgtactatt
gtggaagctctggctaccatccccagccgcaaacagcaggtccttgacctcctgacaagc
tacctggatgagctcagcattgctggcgaatgtgccgccgagtacctggcactgtaccag
aaactcatcaaaccggcccactggaaggtctacctggcagcccggggcgttctgccctat
attggcagcctcatcactaaggaaatagctcgtttacttgccttggaggaagcaacactc
agcactgatttgcagcaaggatatgccttgaagagtctcacaggtcttctctcttccttc
gtggaggtggagtccatcaaacggcacttcaaaagccgcctggtgggtaccgtcctgaat
ggttacctgtgtttgaggaagttagtggtacagagaacaaagctgatcgatgaaacccag
gacatgctgctggagatgctggaagatatgacaacaggcacagaatctgaaaccaaagcc
tttatggcagtgtgtatagagactgcaaaacgttacagccttgatgactacaggactcca
gtcttcatctttgagagactatgcagtattatctatcctgaagagaatgaagtgaccgag
ttctttgtaactctggagaaagatccccagcaggaagacttcttacagggcagaatgcca
ggaaatccctacagcagtaacgagcctggcattgggccactcatgagggacatcaagaac
aaaatctgtcaggactgtgacctggtagctctgctggaggatgacagtggaatggagctt
ttggtgaacaataagatcatcagtttggatctgcctgtggctgaggtctacaagaaggtg
tggtgtcccactaatgagggggagccgatgaggatcatttaccgcatgcgagggttacta
ggagatgcaactgaggaattcattgagtctctcgactccactactgatgaagaggaggat
gaggaagaagtgtataagatggcaggtgtcatggcccagtgtggaggcttggagtgcatg
ctcaacagactgactggaatcaaggacttcaaacaaggccggcacctcttaaccgtgctg
ttaaaactgtttagttactgtgtgaaggtgaaaataaatcgtcagcagttggtcaagccg
gagatgaacactttgaatgtcatgctgggaactcttaacttggctctggtggctgagcag
gaaagtaaggacagcggaggagcggccgtggcagaacaagtgcttagtataatggagatc
atactggatgaatccaacgcagaacctctgagcgaggacaagggtaacctcctcctaact
ggtgacaaagatcagctggtaatgttgctcgatcagattaacagcacttttgtccgttcc
aatctcagcgtcttgcaaggcctgttacgcatcatcccttacctgtcctttggggaaatg
gagaaaatgcagattctggttgatcgattcaagccctactgtaactttgataagtatgat
gaggagcacagtggagatgataaagttttcctagactgcttctgtaaaatagcagcggga
ataaagaacaacagcaacggccatcagctgaaagatctcatccttcagaagggaattacg
cagaatgcccttgactacatgaaaaagcacattcccagtgcaaagaatttggatgcagac
atatggaagaaattcttatctcgacctgcacttccttttatcctccgcctgctccgagga
cttgccacgcagcaccctgctacgcaggtgctaataggtacagactcgattaccaacctg
cacaaactggagcaggtgtctagcgatgaagggatcgggacgctagcagagaatcttctg
gaggcactaagggaacatccagaggtgaacaagaagattgatgctgcccggaaggagaca
cgtgcagagaagaagcgtatggccatggcaatgagacagaaggccttgggcactctgggg
atgacgacgaatgagaagggtcaggtagtgaccaagactgcgctgctcaaacagatggag
gaacttatagaagaaccaggtctgacttgctgcatctgccgggaaggatacaagtttcag
cctacgaaagtcctaggtatttatactttcaccaaacgtgttgcactagaggagtttgag
aacaagccccgaaaacaacagggatacagcacagtctctcacttcaacattgtccactac
gactgtcacctggcagctgtgagacttgctcgcggccgtgaagaatgggagagtgcagcc
ctacaaaatgccaacaccaagtgtaatgggctcctgccagtctggggacctcatgtgcca
gagtctgctttcgctacttgcttagcgcgacacaacacgtacctccaggaatgcacaggc
cagcgggaacccacctaccagctcaatgtccatgacattaaactgctatttctccgtttt
gcgatggagcaatcattcagcgtagatactggaggaggaggaagggagagcaacatacac
ctcattccatacataatccacacggtgctctacgtcctcaacacaactcgagcaacttcg
agggaagagaaaaacctccagagcttcatggagcaccccaaagagaagtgggtggagagt
gcctacgaggtggacgggccccattactacaccgtgctggcgctgcacatctcgcccccc
gagaagtggaaagccatgcgcgtggagatcctcaagaggctcctcatcacctcccacgca
cgagtggtgtcaccagggggagccagcagactggcagataagacagtgaaggaatacgca
acgtaccgctctggccttctcttctgggccctagtagatcttatttacaacatgttcaag
aaggtgcctaccagtaacacagaggggggctggtcctactctcttgctgaattcatacga
cacaatgacatgccaatacatgaagctgcagacaaggccctgaaaaccttccaggaggag
ttcatgccagttgaaacattttccgagtttttggatgtggctggactcttatcagaaatc
aatgatcccgacaacttcctcaaggatcttttgaattccatcccctga

DBGET integrated database retrieval system