KEGG   Nipponia nippon (crested ibis): 104011272
Entry
104011272         CDS       T05756                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104011272 (AKT3)
   04012 ErbB signaling pathway
    104011272 (AKT3)
   04370 VEGF signaling pathway
    104011272 (AKT3)
   04371 Apelin signaling pathway
    104011272 (AKT3)
   04068 FoxO signaling pathway
    104011272 (AKT3)
   04150 mTOR signaling pathway
    104011272 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104011272 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    104011272 (AKT3)
   04218 Cellular senescence
    104011272 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104011272 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104011272 (AKT3)
   04625 C-type lectin receptor signaling pathway
    104011272 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104011272 (AKT3)
   04920 Adipocytokine signaling pathway
    104011272 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    104011272 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104011272 (AKT3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104011272 (AKT3)
  09172 Infectious disease: viral
   05164 Influenza A
    104011272 (AKT3)
   05168 Herpes simplex virus 1 infection
    104011272 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104011272 (AKT3)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104011272 (AKT3)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104011272 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 104011272
NCBI-ProteinID: XP_009461774
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaggaaggctgggttcagaagaggggagaatatataaaa
aactggcggccaagatatttcctgttaaagacagatggctctttcataggctataaggag
aagccccaggatgtggatctgccatatccactcaacaacttttcagtggcaaaatgtcaa
ctaatgaaaacagagcgaccaaagccaaacacgttcattatcagatgtcttcagtggacc
actgtcatagagaggacgttccatgtagacactccagaggaacgggaagaatggacagaa
gcaatccaggctgtagcagacagacttcagaggcaagaagaggagaggatgaactgtagt
ccaacttcacagatagacaatataggagaagaggagatggatgcttcaacaacccatcat
aaaagaaagacaatgaatgattttgactatttaaaactactgggcaaaggcacgtttggc
aaagttatcctggtccgagagaaggctagtgggaaatactatgctatgaagattttgaaa
aaagaagtcattattgcaaaggatgaagtggctcatacacttacggaaagcagagtattg
aaaaacaccagacacccttttttaacatccttgaaatattccttccagacaaaggatcgt
ttgtgttttgtgatggagtatgttaacggaggagagctgtttttccatttgtcgagagag
cgggtgttctcagaggaccgcacacgcttctatggtgcagaaattgtctctgccctggac
tatctgcattctgggaagattgtgtaccgtgatctcaagttagaaaatctaatgttggat
aaagatggacacataaaaattacagattttggactttgcaaagaaggcatcacagacgca
gcaactatgaaaacattctgtggtactccagaatacctggcacccgaggtgttggaagat
aatgactatggtcgtgcagtggactggtggggattaggagttgtcatgtatgaaatgatg
tgtggacgattaccgttctacaaccaagatcatgagaaactatttgaactgatactaatg
gaggacataaaatttcctcgaactctgtctgcagatgcaaaatcattactatcaggccta
ctgataaaggatccaaataagcgacttggtggtggcccagatgatgcaaaagaaatcatg
cgtcatagtttctttgctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtgacatctgagacagacaccaggtattttgatgaagaatttaca
gctcagactattacaataacgccacctgaaaaatatgacgaggatggtatggactgcatg
gacaatgagaggcggccgcatttcccccagttttcctactctgcaagtggacgagaataa

KEGG   Nipponia nippon (crested ibis): 104014534
Entry
104014534         CDS       T05756                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104014534 (AKT1)
   04012 ErbB signaling pathway
    104014534 (AKT1)
   04370 VEGF signaling pathway
    104014534 (AKT1)
   04371 Apelin signaling pathway
    104014534 (AKT1)
   04068 FoxO signaling pathway
    104014534 (AKT1)
   04150 mTOR signaling pathway
    104014534 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104014534 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    104014534 (AKT1)
   04218 Cellular senescence
    104014534 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104014534 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104014534 (AKT1)
   04625 C-type lectin receptor signaling pathway
    104014534 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104014534 (AKT1)
   04920 Adipocytokine signaling pathway
    104014534 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    104014534 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104014534 (AKT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104014534 (AKT1)
  09172 Infectious disease: viral
   05164 Influenza A
    104014534 (AKT1)
   05168 Herpes simplex virus 1 infection
    104014534 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104014534 (AKT1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104014534 (AKT1)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104014534 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 104014534
NCBI-ProteinID: XP_009465471
LinkDB
Position
Unknown
AA seq 480 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEMMDF
RSGSPSDNSGAEEMEVSMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVDNERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagtagcaatagtgaaggaagggtggcttcacaaacgaggagaatacataaaa
acatggaggccgcggtattttctcttaaagaacgatggcacattcattggctacaaggaa
cgaccgcaggatgtcgaccagcgggaatcacctttaaataacttctcagtagctcagtgc
cagctgatgaagacagaacgacctaaaccaaacacatttatcattagatgcctccagtgg
accacagtaattgaaagaacatttcatgtggagactccagaggagcgggaagaatggaca
aaagccatccaaacagtagcagacagcctcaagaaacaagaggaagagatgatggatttc
agatctggctctcccagtgataattcaggtgctgaagaaatggaagtttctatgacaaag
ccaaaacacaaagtgaccatgaatgagtttgaataccttaaactactgggaaaaggcact
tttggaaaggtcattttagttaaagaaaaagcaaccggacggtattatgctatgaaaatt
ctgaagaaggaagttattgtagcaaaggatgaagtagcgcacacgctgacagaaaaccgt
gttttacagaactcgcggcatccattcttaacagctttaaagtattcctttcagacacat
gatcgcttgtgttttgttatggagtatgctaacggaggggagttgtttttccatctgtca
agagagcgtgtcttttctgaagaccgggctcggttttatggagctgagattgtttcagca
ctggattacctgcattcagagaagaacgtggtttatagagatttgaagctggaaaatctt
atgctggataaagatggacacataaaaataacagactttggactatgtaaagaaggcatc
aaggatggagcaacaatgaagactttctgtggcactccagagtatcttgcaccagaggtg
ctggaagataacgactatggtcgtgcagtggactggtggggtttaggagttgtgatgtat
gaaatgatgtgtggccggctcccgttctacaaccaggaccacgaaaagctctttgagctc
atcctaatggaggagattagatttccacgcactttgtcacctgaagcaaaatctcttttg
tcaggtttgctgaagaaagatcctaagcaaaggttaggtggtggtcctgatgatgccaag
gagatcatgcagcacaaattcttcgctggcattgtttggcaagatgtatacgagaaaaag
cttgtacctccgtttaagccacaagttacatctgaaacagatacaagatactttgatgaa
gaatttacagcacagatgataacaatcactcctcctgaccaagatgacagcatggattgt
gtagataacgagagaagacctcattttcctcagttctcctattcagccagtggaaccgct
taa

KEGG   Nipponia nippon (crested ibis): 104020263
Entry
104020263         CDS       T05756                                 

Gene name
AKT2
Definition
(RefSeq) LOW QUALITY PROTEIN: RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04261  Adrenergic signaling in cardiomyocytes
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04620  Toll-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020263 (AKT2)
   04012 ErbB signaling pathway
    104020263 (AKT2)
   04370 VEGF signaling pathway
    104020263 (AKT2)
   04371 Apelin signaling pathway
    104020263 (AKT2)
   04068 FoxO signaling pathway
    104020263 (AKT2)
   04150 mTOR signaling pathway
    104020263 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104020263 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    104020263 (AKT2)
   04218 Cellular senescence
    104020263 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104020263 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104020263 (AKT2)
   04625 C-type lectin receptor signaling pathway
    104020263 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104020263 (AKT2)
   04920 Adipocytokine signaling pathway
    104020263 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    104020263 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104020263 (AKT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104020263 (AKT2)
  09172 Infectious disease: viral
   05164 Influenza A
    104020263 (AKT2)
   05168 Herpes simplex virus 1 infection
    104020263 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104020263 (AKT2)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104020263 (AKT2)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   104020263 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 104020263
NCBI-ProteinID: XP_009471924
LinkDB
Position
Unknown
AA seq 488 aa
MNEVSVVKEGWLHKRGEYIKTWRPRYFXXXXXXXXXXXVGPFIGYKEPPETSDQSLPPLN
NFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPEEREEWMRAIQTVANSLKNQ
EPEADTMDYKCGSPNDGTSAEEMEVAVSKTRAKATMNDFDYLKLLGKGTFGKVILVREKA
TGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYAN
GGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITD
FGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQ
DHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAKEVMEHRFFAPIN
WQDVVQKKLVPPFKPQVTSEIDTRYFDDEFTAQSITITPPDRYDNMGSLENDQRTHFPQF
SYSASIRE
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaacgaagtctcagtcgtgaaggagggctggctgcacaagagaggggaatacatcaaa
acatggcgtccccggtatttcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngtaggc
cccttcatcggctacaaggaaccgccagagacgtctgaccagagcttgccacctctgaat
aacttctcggtagcggagtgccagctgatgaagactgagaggcctcggcctaacaccttc
gtcatccgatgcttgcagtggacaacagtcatcgagaggaccttccacgtggactctccc
gaagagcgcgaggagtggatgcgagccatccagacggtagctaacagcctgaagaaccag
gaaccagaggcagacacaatggattacaagtgtggatctcctaacgacggcaccagcgcc
gaggagatggaggtggccgtcagcaaaacccgcgccaaggctaccatgaatgatttcgat
tacctgaagctcctgggaaagggcactttcggcaaagtcatcttggtgcgggaaaaggcc
accggccgctattacgccatgaaaatactacggaaagaggtcatcattgccaaagatgag
gtagcgcacaccgttacagagagccgggtgctgcagaacaccaggcaccccttcctcacc
gcgctgaaatacgcctttcagacaaacgaccggctgtgcttcgtcatggagtatgccaat
ggtggagagctgtttttccacctctcaagagaacgcgtcttcacagaggaccgagcacgt
ttctatggcgcggaaatagtctctgcactggagtacctgcactcccgggatgtggtgtac
agggacattaagctggaaaatctcatgctggacaaagatggccacatcaaaatcaccgac
ttcgggctctgcaaggaaggcatcacagatggagccaccatgaagaccttctgtggcact
cccgagtacttggctccggaggtcctggaggacaacgattacggccgcgctgtggactgg
tggggcctgggggtcgtgatgtacgagatgatgtgtggccgcctccccttctacaaccag
gaccacgaacgcctctttgagctgatcctcatggaggagatccgcttccctcgtaccctc
agccctgaggccaagtccttgctggccgggctgctcaagaaggatccgaaacagaggctc
ggcggaggtcccaacgacgccaaggaggtgatggaacatcgcttcttcgcccccatcaac
tggcaggacgtggttcagaagaagctggtcccgccattcaagccccaggtgacatccgag
atcgacacacggtatttcgacgatgagttcactgcccaatccatcaccattaccccaccg
gatcgctatgacaacatgggctccctggagaacgaccagcggacacacttcccccagttc
tcctactctgccagcatacgggagtaa

DBGET integrated database retrieval system