KEGG   Nipponia nippon (crested ibis): 104011693
Entry
104011693         CDS       T05756                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104011693 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104011693 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104011693 (KITLG)
Cytokines and growth factors [BR:nni04052]
 Growth factors
  Growth factors (RTK binding)
   104011693 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 104011693
NCBI-ProteinID: XP_009462259
LinkDB
Position
Unknown
AA seq 282 aa
MTTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPKMDS
LPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKN
KDFVKENGHLYEEGRFIPEVFFRHFNSTIEVYKEFADTLDKNDCILPSTVETPENDSRVA
VTKTFLFPPVAASSLRNDSIGSNTSSNKEVLGFISSSSLQGISIALTSLLSLLIGFILGA
IYWKKTHPKSRPESGETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 849 nt   +upstreamnt  +downstreamnt
atgacgacttggattatcacttgcttttgtcttcaactactcctacttaatcctcttgtc
aaagcccagagttcctgcgggaatccagtgacagatgatgtgaatgacattgcaaaattg
gttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaagatggatagt
ctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagtctgcataat
cttctccagaaattttcagatatttcagatatgtctgatgttttaagcaactattcaatc
atcaataatctcacaaggataattaatgatcttatggcatgcctagcttttgataaaaat
aaggattttgtaaaagaaaatggtcacctttatgaagaaggtcgcttcattcctgaggtt
ttttttaggcactttaatagtaccattgaggtctacaaggagtttgcagacacattggat
aagaatgactgcattctgccttcaacagtagaaacaccagagaatgattccagagtcgct
gtcacaaaaacatttttgtttcctcctgttgctgccagctcccttaggaatgacagcatt
ggcagtaacactagcagtaacaaagaggtacttggcttcattagcagctccagcctgcaa
gggatcagcatagcactgacatcattgctgtctcttcttattggctttattttgggagct
atatactggaagaaaacacatcccaaatccagaccagaaagtggtgaaactacacagtgt
catgactgtcaagaggaaaatgagataagtatgttgcagcaaaaagaaaaagaacatcta
caagtgtag

DBGET integrated database retrieval system