KEGG   Nipponia nippon (crested ibis): 104012053
Entry
104012053         CDS       T05756                                 

Definition
(RefSeq) interleukin-4-like
  KO
K05430  interleukin 4
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04060  Cytokine-cytokine receptor interaction
nni04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104012053
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    104012053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104012053
   00536 Glycosaminoglycan binding proteins [BR:nni00536]
    104012053
Cytokines and growth factors [BR:nni04052]
 Cytokines
  Interleukins
   104012053
Glycosaminoglycan binding proteins [BR:nni00536]
 Heparan sulfate / Haparin
  Cytokines
   104012053
SSDB
Motif
Pfam: IL4 CD45
Other DBs
NCBI-GeneID: 104012053
NCBI-ProteinID: XP_009462668
LinkDB
Position
Unknown
AA seq 215 aa
MSGCGPWSGGAPGLKWKPAGSKEALHAGEGTVSRWAREGTGLAHGMSARLGAGSSRKAHT
GIDHQNIQKLRAEEVQSKQAMSVPVSVLLTFLALSACQGHTATQLQTANFLKESIMLLNK
LLESKVSCNKTNVPSIFAGDKKDNDIETLCKATTVTLEHQSCHKYLKGIHLNLVHFVQRK
STAYKAPCPVAAGNTTSLNDFLQDLRRLLQQLVKG
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtcggggtgtggaccctggtccgggggggcaccagggctgaaatggaaaccagcgggc
agcaaagaggcgctgcatgcaggggaaggcacggtcagccgatgggcgagggaagggacg
gggctggctcatgggatgagtgcccgcctgggtgccggcagcagcagaaaagcacacaca
ggtatagatcaccaaaatatccagaaactgcgagctgaggaggttcagtccaagcaggcc
atgagcgtcccggtctcggtcctgctcaccttcctggcgctgtcagcctgccagggccac
acggccactcagctgcagaccgccaactttctgaaggagagcatcatgctgctgaacaag
ctcctagagagcaaggtttcctgtaacaagacgaacgtgccaagtatttttgcaggcgat
aagaaagacaacgatatagaaaccttatgcaaagccaccacggtcactttggagcaccag
agctgccacaagtacctgaagggcattcacctcaacttggtccatttcgtccaaaggaag
agcacagcctacaaggcaccatgtcccgtagcagcaggcaacactacttccctgaatgat
ttcctgcaggacttacgcagactcctccaacaactagtaaaaggctag

DBGET integrated database retrieval system