KEGG   Nipponia nippon (crested ibis): 104012111
Entry
104012111         CDS       T05756                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04310  Wnt signaling pathway
nni04510  Focal adhesion
nni04520  Adherens junction
nni04916  Melanogenesis
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104012111 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104012111 (CTNNB1)
   04520 Adherens junction
    104012111 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    104012111 (CTNNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104012111 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 104012111
NCBI-ProteinID: XP_009462736
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRPDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggcaacccaagctgacttgatggagctggatatggcaatggagccagacagaaaagca
gcagtcagtcattggcagcaacaatcgtatctggactctggtatccattctggtgccaca
acaactgctccctccttgagtggcaagggaaatcctgaggaggaagatgtggacacgacg
caagtcctgtatgagtgggagcagggattctctcagtcgtttacccaggagcaagttgct
gatattgatggccagtatgcaatgactagagctcagagagtgcgtgcggctatgttccct
gaaacactggatgaaggaatgcaaatcccatccacacaatttgacgctgctcatccaact
aatgtgcaacgcctggctgagccatcccagatgttaaaacatgctgttgttaatttgata
aactaccaagatgatgcggaacttgcaactcgtgcaatcccagaactgaccaaactgttg
aatgatgaggaccaggtggtggtgaacaaggctgcagttatggttcatcagttatccaaa
aaggaagcatctcgccatgctattatgagatctcctcaaatggtatctgctattgtgcgt
accatgcaaaatacaaacgatgtggaaacagcccgttgtactgcaggtacactacacaac
ctctcacatcaccgtgaaggcttgttggcaatcttcaaatcaggaggcatccctgctttg
gttaaaatgcttgggtctccagtggactctgtgctgttctatgccattacaactcttcac
aatctcttgttgcatcaggaaggagccaaaatggctgtccgtctagctggtgggctgcag
aaaatggttgccttgctcaacaagacaaatgtcaaattcttggccatcacaacggactgc
cttcagattttagcgtatggcaatcaagaaagtaagctgattattctggcaagtggtgga
ccccaggctctagtaaacataatgaggacctatacttacgagaaactgttgtggaccaca
agtagggtgctgaaggtgttgtcagtctgctccagcaacaaacctgctattgttgaagct
ggtgggatgcaagctttgggactccacctcacagatccaagccagcgtcttgtccagaac
tgtctctggactctgagaaatctgtcagatgctgcaacgaagcaggagggaatggaaggc
cttctaggaactcttgttcagcttttaggatcagatgatattaatgttgtgacttgtgct
gctggcatcctttctaaccttacctgcaacaattacaagaacaagatgatggtgtgccag
gttggtggcatcgaggctcttgtgcgcacagttcttcgggctggagacagggaagacatc
acagaacctgctatttgtgcgctccgtcacctcaccagcagacatcaagaagctgagatg
gctcaaaatgcagtacgtctccattatggactcccagtggtggttaaactgttgcacccg
ccatcacactggcctttgatcaaggctactgttggtttgatccgcaatcttgctctctgt
cctgcaaaccacgccccactgcgtgaacaaggtgctattccaaggctagttcagttgctg
gttagagcacatcaagatacccagcgacgtacttctatgggtggaacacaacagcagttt
gtggagggtgtgcgtatggaagaaattgtcgagggctgcactggagccctgcatattctt
gcacgcgatgttcataatcgaatcgtaatcaggggtctaaataccattccactatttgtg
cagttgttgtactctcccattgagaacatccagagagtagctgcaggggtgctctgtgaa
ctggctcaagacaaggaagcagctgaagcaattgaagccgaaggtgcaactgctccttta
acagaactgcttcattctaggaatgagggtgttgcaacatacgcagctgcggtgctgttc
aggatgtctgaggacaaaccacaagactacaagaagcgactttcggttgaattgacaagc
tctctgttccggactgagccaatggcttggaacgagacggcagatctcggacttgatatt
ggtgcccagggagaacctcttggataccgcccagatgatcctagctaccgttctttccac
tctggcggatacggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatggtctgccagatcttggccatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system