KEGG   Nipponia nippon (crested ibis): 104012614
Entry
104012614         CDS       T05756                                 

Gene name
BTRC
Definition
(RefSeq) F-box/WD repeat-containing protein 1A
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04114  Oocyte meiosis
nni04120  Ubiquitin mediated proteolysis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104012614 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104012614 (BTRC)
   04340 Hedgehog signaling pathway
    104012614 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104012614 (BTRC)
   04218 Cellular senescence
    104012614 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nni04121]
    104012614 (BTRC)
   03036 Chromosome and associated proteins [BR:nni03036]
    104012614 (BTRC)
Ubiquitin system [BR:nni04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     104012614 (BTRC)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     104012614 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 104012614
NCBI-ProteinID: XP_009463274
LinkDB
Position
Unknown
AA seq 605 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALPAFQNSSEREDC
NNDEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLGSTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLSERRGWGQYLFKNKPPDGTAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPTAQAESTRSPSRTY
TYISR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggacccggccgaggccgtgctgcaggagaaggccctcaagttcatgtgctctatgccc
agatctctgtggctgggctgctccagcctggcggacagcatgccctcgctgcgatgcctg
tataacccagggactggcgcactcccagctttccagaattcctctgagagagaagactgt
aataatgatgagccccctaggaagatcattcccgagaagaattcacttagacagacctac
aacagctgtgccagactgtgcttaaaccaggaaacagtatgtctaggaagcactgctatg
aagactgaaaattgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaaagaaaactgtctgcaagctatgagaaggagaaggaactctgcgtcaagtat
tttgaacagtggtccgagtctgaccaggtggagttcgtggagcacctcatctcccagatg
tgtcactaccagcacggacatataaactcatacctcaaacccatgttacagcgggacttc
atcactgcactgccagctcggggattagatcacattgctgagaacattctgtcatacctg
gatgccaaatcgttgtgtgctgctgagctggtgtgcaaggagtggtaccgggtgacgtcg
gacggcatgctgtggaagaagctcatcgagagaatggtcaggacagactccctgtggagg
gggttgtcagagaggagaggatggggacaatatctatttaaaaataaacctcctgatggg
actgcaccacccaactccttctacagagcactttaccccaaaattatacaggacatagag
acaatagagtcaaactggcggtgtggaaggcacagtttacagaggatccactgccgaagc
gagacaagcaaaggggtttattgtttacagtatgatgatcagaagatagtaagtggccta
cgagacaatactattaagatctgggataagaatacattggaatgcaagcgaattctcacc
ggacacacgggttctgtcctgtgcctccagtacgatgaacgggtgatcattactggatct
tcggactcaacagtcagggtgtgggacgtgaatgcaggcgagatgctgaatactctgatt
caccactgcgaagcagtactgcacctccgcttcaataacggcatgatggtgacctgttcc
aaagaccgctccattgctgtgtgggacatggcttcaccaacagacatcaccctgaggagg
gtgctagtagggcaccgagctgccgtcaacgtagtggactttgatgacaagtacattgta
tcagcatcaggtgacagaactataaaggtatggaacactagtacctgcgaatttgtgcgc
accttaaatggccacaaacgaggcattgcatgtctgcagtacagagacaggctagtagtg
agcggctcttcagataatactatcaggctgtgggatatcgagtgtggggcatgtttacga
gtactggaaggccatgaagagttggtgagatgcatacgctttgataacaagaggatagtc
agcggggcatatgatgggaaaattaaagtatgggatcttgtggctgctttggaccctcgt
gctccagcagggaccctctgcttgcgaactcttgtggagcattctggaagagtctttcga
cttcagtttgacgagttccagatcgtcagcagctcacatgatgacaccatcctcatctgg
gattttctgaatgacccaactgcccaagcagaatccactcgttccccgtccagaacatac
acctacatctcaagataa

KEGG   Nipponia nippon (crested ibis): 104016560
Entry
104016560         CDS       T05756                                 

Gene name
FBXW11
Definition
(RefSeq) F-box/WD repeat-containing protein 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04114  Oocyte meiosis
nni04120  Ubiquitin mediated proteolysis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104016560 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104016560 (FBXW11)
   04340 Hedgehog signaling pathway
    104016560 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104016560 (FBXW11)
   04218 Cellular senescence
    104016560 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nni04121]
    104016560 (FBXW11)
   03036 Chromosome and associated proteins [BR:nni03036]
    104016560 (FBXW11)
Ubiquitin system [BR:nni04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     104016560 (FBXW11)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     104016560 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 104016560
NCBI-ProteinID: XP_009467738
LinkDB
Position
Unknown
AA seq 531 aa
MCALRCLQSMPSVRCLQNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYEK
EKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHI
AENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYL
FKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDE
KIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGE
VLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDF
DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIE
CGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEH
SGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgcgcactgagatgcctgcagagcatgcccagtgtcagatgtctccagaacacgtca
gtaatggaggatcagaatgaagatgagtctccaaagaaaaataccctatggcagataagt
aatggaacttcatctgtgattgtctcaagaaaaagaccatcagaaggaaactacgaaaag
gaaaaagacttgtgtattaaatattttgaccagtggtctgaatcagatcaagttgaattt
gtggaacaccttatttcacgaatgtgtcactatcagcatggacatattaactcttacttg
aagcccatgttacaacgggacttcatcactgcgttaccagagcaaggcttagatcacata
gcagaaaacatcctttcctatcttgatgccagatcactctgtgcagcagagctggtatgt
aaggaatggcagagagtcatctctgagggaatgctatggaaaaaattgattgaaagaatg
gtacgcacagatccgctatggaagggactgtcagaaagaaggggttgggatcagtacctg
tttaaaaacagaccaacagatggccccccaaattcattttacaggtccttatacccaaag
ataatacaggatatagagactatagaatctaactggcgatgtgggcgacacaatttgcaa
aggattcagtgccgctctgaaaacagcaaaggtgtctactgtttacagtacgatgatgaa
aagattatcagtggcctacgagataactccattaagatttgggacaaaacaagcttggaa
tgtttgaaagtattaacaggacataccggctcagttctttgtctgcagtatgatgaaaga
gtcattgtaactggatcttcagattctacagtgagagtttgggatgtaaatacaggtgaa
gttctgaacacgttgattcatcacaacgaggcagtacttcatttgaggttcagtaatggc
ttaatggtgacatgctcaaaggacagatcaattgctgtttgggatatggcatcacctact
gacatcaccctgcgccgtgtcttagttggccatcgtgctgccgttaacgtggtagacttc
gatgacaagtatattgtgtcagcgtcaggtgacaggaccattaaagtctggagtacaagt
acgtgcgagtttgttcgtactctaaatgggcacaagcgtggcattgcatgcctccagtac
agggatcgactagttgtcagtggatcttcagacaataccattaggctatgggacattgaa
tgcggtgcctgtttaagagtattagaaggccatgaagaactggttcgatgcattaggttt
gacaataagaggattgttagtggagcctacgatggcaaaattaaagtttgggacttgcaa
gctgctcttgaccctcgtgccccagcaagtacattatgcttgcgtacattagtggaacat
tcaggacgtgtctttagactccagtttgatgaatttcagatcattagtagttcccatgat
gatacaattctgatttgggatttcttaaatgtgccacccagtgcccagaatgagactcgc
tctccatctagaacatacacttacatctccagataa

DBGET integrated database retrieval system