KEGG   Nipponia nippon (crested ibis): 104012649
Entry
104012649         CDS       T05756                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04115  p53 signaling pathway
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104012649
   04068 FoxO signaling pathway
    104012649
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104012649
   04115 p53 signaling pathway
    104012649
   04218 Cellular senescence
    104012649
SSDB
Motif
Pfam: CDI Coat_F
Other DBs
NCBI-GeneID: 104012649
NCBI-ProteinID: XP_009463307
LinkDB
Position
Unknown
AA seq 153 aa
MERRPGKTTRAQRNLFGPVDHEQLRQDFQHMLRNSVEGAQQKWNFDFLRDTPAKGLLQWE
ELEGHEVPAFYHSCVVGDARRPLQHLNWPLGREDRSHHFAQLALTEKPKTSKKTGGKRIS
EGKKRRQTSLTDYYSAKKRDKTNTQAATKKSTS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagcggaggccggggaagacaacccgcgcccagaggaacctctttggccccgtagac
cacgagcagctgcggcaggacttccagcacatgctgcgcaacagcgtcgagggggcccag
cagaagtggaacttcgatttcctccgggacacgccggcgaaggggctcctgcagtgggaa
gagcttgagggccacgaggtacccgccttctaccacagctgcgtggtgggggatgctcgg
agaccactgcagcacttgaactggccgctgggcagggaggacaggagtcaccactttgcc
cagctggcactgactgagaaacccaaaacttccaagaaaacagggggcaagaggatctca
gaagggaagaaaagaagacagacatctttgacagattactactcggcaaagaagcgagac
aaaacgaatacgcaagctgctacaaagaagtcaacttcttga

DBGET integrated database retrieval system