KEGG   Nipponia nippon (crested ibis): 104012694
Entry
104012694         CDS       T05756                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04114  Oocyte meiosis
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104012694 (ITPR2)
   04020 Calcium signaling pathway
    104012694 (ITPR2)
   04070 Phosphatidylinositol signaling system
    104012694 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104012694 (ITPR2)
   04210 Apoptosis
    104012694 (ITPR2)
   04218 Cellular senescence
    104012694 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104012694 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104012694 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    104012694 (ITPR2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104012694 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104012694 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104012694 (ITPR2)
Ion channels [BR:nni04040]
 Ligand-gated channels
  IP3 receptor
   104012694 (ITPR2)
SSDB
Motif
Pfam: RYDR_ITPR MIR Ins145_P3_rec RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 104012694
NCBI-ProteinID: XP_009463360
LinkDB
Position
Unknown
AA seq 2652 aa
MNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEIVKYSNVIQ
LLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIQPFWKLRSEGDNVVVGDKV
VLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYRDDVLKGGDVVRL
FHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSL
FRFKHLATGNYLAAELNPHYPEGNNEGKALRDGDLPASKKKRQAGEKIMYTLVSVPHGND
IASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQT
KEDKEAFAIVSVPLSEVRDLDFANDANKVLASTVKKLENGTITQNERRFVTKLLEDLIFF
VADVPNNGQEVLDVVITKPNRERQKLMREQNILAQIFGILKAPFKDKGEGSMLRLEDLGD
QRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHNNR
KLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGNAD
ILIQTKLVSTQMDNPLECPVISDDIDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKAD
LEVLTYYRYQLNLFARMCLDRQYLAINQISAQLSVDLILRCMSDESLPYDLRASFCRLML
HMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSFTDSSRNEMKRKFALTMEFVEEYLK
EVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPISSY
FERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPISAPDVQPSIHPSKQASTSDSED
VIVMDTKLKIIEILQFILSVRLDYRISYMLSIYKREFGENNENVDSSTTSPPDSPGIASA
IVPDIDEIAAQAETMFAGRYEKNAXXXXXXXXXXXXXXXVQLDDEGGRTFLRVLIHLIMH
DYPPLLSGALHLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSE
LWVEKNSNYESGEVGDNQTKGGEEPIEESNILSPIQDGTKKPQIDSNKSNNYNIVKEILI
RLSKLCVQNKKCRNQQQRLLKNMGAHLVVLDLLQIPYEKSDEKMNEVMNLAHTFLQNFCR
GNPQNQVLLHKNLNLFLTPGLLEAETMRHIFMNNYLLCNEISERVVQHFVHCIETHGRHV
EYLRFLQTIVKADGKYVKKCQDMVMTELINGGEDVLIFYNDRASFPVLLQMMCSERDRAD
ESGPLAYHVTLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFV
NHCYVDTEVEMKEIYASNHIWKLFENFLVDMARVCNTTTDRKHADTSLEKYVTEPVMNIV
SGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPTQKASVESCIKTLAEVAKNR
GIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRMSARSGPRFKEALGGPAWDYRNIIEKLQ
DVVSSLEQQFTPMMQAEFSVLVDVLHSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKE
EKLCIKILQTLREMLDKKTNFAEEGNTLRKILLYRYFKGEYGSGMNGPLSASYSKTAQVG
GGFSGQESDKSGVTMFDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNT
QTQYSTYQQLKEQKKSEKFFKVLYDHMKAAQQEIRSTVTVNTIDLGSKKKDDDSDLTISV
PKKRVKDSTLHLKEGMKGQLTEASSATSKAYSVYRREMDPEIDLMGSGTDAANAEEKSTE
EAIMSPAIAIMQPILRFLQLLCENHNRELQNFLRHQNNKTNYNLVCETLQFLDCICGSTT
GGLGLLGLYINERNVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDIN
PLGKYCMDLVLQLKNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLEC
DHEEENGDDGISPKDVGHNIYILAHQLARHNKTLQQMLKPGSDPDEGDEALRYYANHTAQ
IEIVRHDRTMEQIVFPVPNICEFLTRESKSRVFNTTERDEQGSKVNDFFQQTEDLYNEMK
WQKKIRNNPPLFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSLLLW
IAVAFCTAMLFFISKPVGIRPFLVSVILRSIYTIGLGPTLILLGAANLCNKIVFLVSFVG
NRGTFTRGYRAVIMDMAFLYHVAYVLVCMLGLCVHEFFYSFLLFDLVYREETLLNVIKSV
TRNGRSIILTAVLALILVYLFSIIGFLFLKDDFIMEVDRLKIRTPVAGIGEVPTTTLTSM
VGACAKENCSTSIPIINPGEEEEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRKPSK
DEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLER
DKFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRM
RAMSLVSNEGDSEQNEIRNLQERLESTMSLVKQLSSQLAELKEQMTEQRKNKQRLGFLGS
NTPHVNHHMPPP
NT seq 7959 nt   +upstreamnt  +downstreamnt
atgaaccgatattcagcccagaagcagtactggaaagccaagcaagccaaacaaggaaac
catacagaagcagcactgctgaagaaacttcaacatgcagcagaactggaacaaaagcag
aacgaaagcgagaacaggaagctgttgggcgaaattgtaaaatatagcaacgtcatacag
ctactgcacataaaaagtaacaagtacctcacagtcaataagagattgccagctctgcta
gagaagaatgctatgcgggtgtctctggatgctgcagggaacgagggatcctggttttat
atccagccgttctggaaactgaggagtgaaggtgacaatgttgttgtgggagataaagtt
gttctcatgccagtcaatgcagggcagcctctacatgccagcaacattgagcttctagat
aaccctggctgcaaagaggtaaatgctgtcaactgtaacacaagctggaaaataactttg
tttatgaagttcagtagttaccgagatgatgtactgaaaggaggagatgttgttaggctg
tttcatgcagagcaagagaagtttctgacctgtgacgaatatgagaagaaacaacatatt
ttccttcgtactacattacgtcagtcagccacttctgcaacaagttctaaagcgctgtgg
gaaatagaggttgtccatcatgacccttgccggggaggggcaggacagtggaacagcttg
tttagatttaagcatttggcaactggaaactacttagctgcagagcttaacccacactat
ccagaaggtaataatgaaggaaaagctttgagagatggcgaccttcctgcttcaaagaag
aaacgccaagcaggggagaagattatgtatactttggtctctgtgccacatggaaatgac
atcgcatctctctttgaactggatgccaccactcttcagagagctgattgcctggttcca
aggaactcatacgtccgactgaggcatttatgcactaacacttgggtcactagcaccagc
attccaatagacactgatgaggagaggcctgtgatgttaaagattgggacgtgccaaaca
aaagaggacaaggaagcttttgccattgtatcggttcctctgtctgaggtcagagacttg
gactttgccaatgatgcaaacaaggttctagcatcaactgttaaaaagctggagaatgga
acaataacccagaacgaaaggaggtttgtaaccaagttactggaagatctcattttcttt
gttgctgatgtgcctaataatgggcaggaagttttggatgtggtcattaccaagccaaac
cgggaacggcaaaaattaatgagggaacaaaatatattggctcagatattcggcatcctc
aaagctccttttaaggacaaaggtgaaggatcaatgctgagacttgaagacctaggtgac
cagagatatgctccatacaaatacatgttaaggttatgttacagagttctcaggcattcc
caacaggactataggaagaaccaggaatatattgctaagaacttctgcgtcatgcagtcc
cagattggttatgatattctggcagaagacaccatcacagctttgttgcacaacaacaga
aaactgctagagaaacacatcacggctaaagaaatagagacatttgttaatttactcagg
agaaatcgagagccaagattcttggattatctatcagacctgtgtgtatctaacaccaca
gcaataccagtaactcaggaactcatctgcaagtttatgctgagcccagggaatgctgac
attctcatacagaccaagctggtttcgacacaaatggacaatcccttggaatgcccagtc
atctcggatgacattgatgaagaggaagtgtggctttactggattgacagtaacaaggag
cctcatggcaaagccatcaggcatctggctcaggaggcaaaggagggcacaaaagcagat
ttagaagttcttacttactacaggtaccaactgaacctctttgccagaatgtgcctggac
cgccaatatctagctatcaaccagatttctgcgcagctatcagtagacttgatcctacga
tgtatgtctgatgaaagcctcccttatgacctccgggcttctttttgccgactgatgcta
cacatgcatgtggacagagatcctcaggaatctgtggtacctgtcagatatgccagattg
tggactgaaattcctactaagatcacaattcatgagtatgattctttcacagactcttcg
aggaatgaaatgaagaggaagtttgcgctaactatggaatttgtagaagagtacttgaaa
gaagttgtaaatcagccctttccatttggagacaaagagaaaaataaacttacatttgag
gtggtacatctggctcgaaacctcatatactttggcttttatagttttagtgagctgctc
agactgacccggacgctgctggcaattctagatatcgttcaagttcctatatcatcatac
ttcgaaaggttgagcaagtttcaggatggaggaaacaacgttatgaggaccatccatggt
gtaggagagatgatgacccaaatggtactgagcagaggatctatatttcccatcagtgcc
cctgatgtacagccaagcattcacccaagcaagcaagccagtacctcagacagtgaagat
gtgattgtaatggacaccaaattgaaaatcattgagattttgcagtttattctcagcgtt
agactggactatagaatatcctacatgctgtctatctataagagggagtttggggaaaac
aatgaaaacgttgatagctctacaacatccccgcctgactcaccagggattgcctcagca
attgttcctgacatagatgaaattgcagctcaggctgaaaccatgtttgctggcaggtat
gagaagaatgcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncggtt
cagcttgatgatgaagggggcagaacttttttacgggtcctcattcacctcatcatgcat
gactaccctcctttgctctcaggtgctctgcacctgctatttaagcacttcagccagcga
gcagaagttctgcaagcatttaaacaggttcagttgctggtgtctaatcaagatgttgat
aactacaagcaaatcaaggctgatcttgatcagctacgtctgactgtagaaaaatcggaa
ttgtgggttgagaagaacagcaattatgagagtggagaggtgggcgacaatcaaaccaaa
gggggagaagagccaatagaggagtcaaatattttgagtccaatacaggatgggaccaaa
aaaccccagatagacagcaacaaaagcaataactacaatattgttaaagagattttgatt
cgactcagcaaactttgtgttcagaataaaaaatgtcggaatcaacagcagcgattgctg
aaaaatatgggcgcccacttggtagtcttggaccttctgcagataccctatgaaaagagc
gatgaaaagatgaatgaagttatgaatctagcccacactttccttcagaatttctgtcga
ggaaatcctcagaatcaagttctcctccacaaaaatctcaacttgttcttgactccgggg
ctcctggaagctgaaaccatgcggcacatcttcatgaataattaccttctgtgtaatgaa
attagtgagagagtggtgcagcactttgtacactgcattgagacccatggccgtcacgtg
gagtacctgcggttcctgcagaccattgtgaaagcagatggcaaatatgtgaaaaaatgc
caggacatggtaatgacagagctgataaatggtggtgaagatgtgttgatattctacaac
gacagagcatcatttccagtcctactccaaatgatgtgctcagagcgagatcgagcagac
gagagcggacccttagcatatcacgtcactctagtggaattgctagcggcttgtacagaa
ggaaagaatgtatacacagagatcaagtgcaattcactcctgccactggatgatatagtg
agagtagtgacccatgatgactgcatacctgaggtgaaaatagcctatgttaattttgtt
aaccactgttatgtggacactgaagtggaaatgaaagaaatctatgccagcaaccatatt
tggaagttatttgagaacttccttgttgatatggcaagggtttgtaacacaaccacagat
cgtaaacatgcagacacatctctggagaaatatgtcactgagcccgtaatgaacattgtg
agtggcttcttcaattcgccattttcagataacagcaccagcctccagacacaccagcct
gtttttattcagctgctgcagtctgcttttagaatttacaactgtacctggccgaaccca
acgcagaaagcctcagtggagtcgtgtatcaagactttggctgaagtggcaaagaaccgt
gggattgcaattccagtggatttggacagccaggtcaacaccttgttcatgaagagtcac
tctaacatggtgcagagggcagccatggggtggagaatgtcagcccgcagtggacctcgt
tttaaagaagctcttggtgggcctgcctgggattacaggaatataatagaaaaactacag
gatgtagtgtcctccttggagcagcagttcactcccatgatgcaagctgaattctcggtg
ctggttgatgtgctgcacagtccagaacttctttttcctgagggaagcgatgccagaata
agatgcggtgctttcatgtccaagttgattaatcacacaaagaagctaatggagaaggaa
gaaaagctctgcattaaaattcttcagacgttacgagaaatgcttgacaagaaaactaac
tttgcggaagagggcaacactttaaggaaaatactcctatatcgctactttaaaggagaa
tatggaagtggtatgaatgggcctctgtctgccagctacagcaaaactgcacaagtggga
ggtggattttcaggacaagagtcagataagtctggggtaaccatgtttgatattcagtgc
cttctggataaagaaggtgcatcagaactagtcatagatgttatagtaaacaccaaaaat
gacagaattttctcagaaggcattttgcttggtattgcattgcttgaaggtggaaatacg
caaacacagtattcgacttaccagcaactgaaggagcaaaaaaagtcagaaaaattcttt
aaagtcctgtatgaccacatgaaagctgctcagcaggagatacgatcgacagtgacagtg
aacactattgatttggggagcaaaaagaaagatgatgatagtgacctaaccatatctgtt
cccaaaaagagagtaaaggattcaaccctgcatctgaaagagggtatgaaaggacagtta
acagaagcatcttctgcaacgtccaaggcttactctgtgtatagaagagaaatggaccca
gaaatagatcttatgggctcaggaacagatgctgcaaatgcagaagagaagtccacagaa
gaagcaatcatgagccctgccattgcaatcatgcagccaatattgagatttcttcagctg
ttgtgcgagaaccacaaccgagagctccagaattttttaagacatcagaacaacaaaaca
aattacaaccttgtttgtgagacccttcagtttttggactgtatctgtggaagcacaaca
ggcggactgggcctactggggctttacatcaacgagaggaatgtggctcttgtgaaccag
acactggaaagcttgactgaatattgccaaggtccatgccatgaaaatcagacttgcata
gccacccatgaatctaatgggattgatattataattgcactcatcttgaatgacataaac
cctcttggcaaatactgtatggacttggtgcttcagctaaagaacaatgcctccaagctt
ttgctggctattatggaaagcaggcatgacagtgagaatgcggaaagaatccttttcaac
atgagaccaagggaactggtggatgtgatgaagaatgcatataaccaaggcctcgaatgt
gaccatgaggaggagaatggagatgatggcatctccccaaaagatgttggccataatatc
tatattttggcacatcagttggctcgtcacaataaaacattgcaacagatgctgaagcca
gggtcagatccagatgaaggagatgaagccttgaggtattatgccaatcatacggcacag
atagagattgttcgccacgatagaacaatggaacaaatcgtcttccctgtccccaatatt
tgtgaattcctcactcgggaatccaaaagtagggtattcaatacaacagagagagatgaa
caagggagcaaagtcaatgactttttccaacagacagaggatctgtacaacgagatgaaa
tggcaaaagaaaattcggaataatccacccctgttttggttctccagacacatctctctc
tgggggagcatttccttcaaccttgctgtattcatcaatttagcagttgctctgttctac
ccctttggagatgatggagatgaaggcacgctctctccgttgttttccctcctcctttgg
atagcagtggcgttttgcacagcaatgctgtttttcatctccaagcctgttggtattcga
ccctttttggtgtctgttattctcaggtctatatatactatagggctcggtcctaccttg
atacttcttggtgctgctaatctttgtaacaaaatagtgtttctggtgagctttgttggg
aaccgtggaacttttacccgtggctacagagcggtcatcatggacatggcttttctctat
cacgtagcatatgtcctcgtctgcatgctgggcctctgtgtgcatgaattcttctatagt
ttcctgctgtttgatctggtgtacagagaagagactttgctaaatgtgataaaaagtgtt
acccggaatggtcgttccattatcctcactgcagtgctagcactcatcttagtttatctc
ttctccatcattgggttcctcttcttgaaagatgacttcatcatggaggtcgacagattg
aaaatcaggacccctgttgcaggtattggtgaagtccccactacaaccctcacatcaatg
gtgggagcctgtgcaaaagagaactgttccacaagcatcccaattattaacccaggtgaa
gaggaggaggatggaatagaaaggacctgtgacaccctgctcatgtgcattgtgaccgta
ttaaaccaaggcctgcgaaatggtggtggtgtgggagacgtgctcagaaagccttccaaa
gatgagcccttgttcgctgcgcgagttgtttatgatcttctcttttacttcattgtcata
attattgttctaaacctaatctttggagtcatcattgatacatttgctgatctcaggagt
gaaaagcagaaaaaggaggaaatactaaagacaacctgtttcatctgtggactggagaga
gacaaatttgataacaagaccgtttcgtttgaggagcatataaagtcagaacacaacatg
tggcattatttgtactttatagttcttgtcaaagttaaagatccaacggaatacactggc
ccggagagctacgtggcgcaaatgattgtggagaagaacttggactggttccctcggatg
agagccatgtccctggttagcaatgaaggcgacagtgagcaaaatgaaatcaggaacctg
caagagaggctggagtcaaccatgagccttgtaaaacagctttccagtcagcttgctgag
ctcaaggaacagatgacagaacaaaggaagaataagcagaggctgggctttcttggatca
aacacaccccatgtgaatcatcacatgccaccaccctga

KEGG   Nipponia nippon (crested ibis): 104013165
Entry
104013165         CDS       T05756                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04114  Oocyte meiosis
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104013165 (ITPR3)
   04020 Calcium signaling pathway
    104013165 (ITPR3)
   04070 Phosphatidylinositol signaling system
    104013165 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104013165 (ITPR3)
   04210 Apoptosis
    104013165 (ITPR3)
   04218 Cellular senescence
    104013165 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104013165 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104013165 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    104013165 (ITPR3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104013165 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104013165 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104013165 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104013165 (ITPR3)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104013165 (ITPR3)
Ion channels [BR:nni04040]
 Ligand-gated channels
  IP3 receptor
   104013165 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans SopA
Other DBs
NCBI-GeneID: 104013165
NCBI-ProteinID: XP_009463913
LinkDB
Position
Unknown
AA seq 2664 aa
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELADNAGCKEVNSVNCNTSWKINLFMQFCDHMEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDVAEPKAAPTGGSSRASRRNTGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASVVEKMNEGFLSQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIVVTKPNRERQKLMREQNILKQIFGILKAPFKDKGGEGPLVRLEE
LSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIKTELRPVKEMSQTHEYLSIEYSEEEVWLTWTDKNNDHHEKSIRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIKEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVMPVKFARLWTEIPTAITIKDYDSNLNVSRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQNPQL
MMQAVYNDEVTGKNVRRSIQGVGQMMSTMVLSRKQSIFSPPSLSAGSAPEQVDRGRSIEN
ENIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVYPMQDSAADGTAPAFDST
TAAMNLDRIGEHAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYPPLISGSLQLLF
KHFSQRQEVLHTFKQVQLLISAQDVENYKVIKSELDKLRTMVEKSELWVDKKGSSKGDST
VEGNKKEKKEHAADEEVIAPGEKSSENYQIVKGILERLNKMCGVGEQVRKKQQRLLKNMD
AHKVMLDLLQIPYEKGDAKMMEILKFTHQFLQKFCAGNQENQALLHKHLNLFLTPGLLEA
ETMQHIFLNNYQLCSEINETVPQHFIHCVATHGRHVQYLDFLHTIIKAEGKYVKKCQDMI
MTELTNAGDDVVVFYNDKASLATLLEMMTAARDGVEENSPLMYHISLVDLLAACAEGKNV
YTEIKCTSLLPLEDVVRVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLF
ENFTLDMAQMCKKREKRLPDPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQL
LQSTMRLLECPWLQQQHKSSVEACIRTLAMVAKSRSIALPMDLDAHVSSLLNSSSTNTVQ
RNTSNYKTATRTFPRVSTTPNQWDYKNIIEKLQDIISALEDRLKPLVEAELSVLVDVLHR
PELLFMEGTEAFQRCESGGFLSKLVQHTKDLMETEEKLCIKVLRTLQQMLVKRNKYGERG
NLLRKMLLNNYLQNKKSSSKGEIMDAAGGGQDQDWSAIAAVQCRLDREGATKLVADLIMN
TKNEKIFQESILLAIRLLDGGNTEIQKSFYNLMTSDKKSEKFFKVLHDRMKKAQQETKST
VSVNMSDIGNKPREDKDEPDPGTKGRGDTFVMPGTPSRYPMAVGFRKGHDTGEQGQNNEM
GVTVLIMEPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLG
LLGLYINEYNVALITQTLETLTEYCQGPCHENQSCIVTHESNGIDIITALILNDISPLCK
YRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEECENAE
VSPREVGHNIYILALQLSRHNRSLQQLLKPVKRIQEEEEEGISSMLSLNNKQLTQMLKST
APVQEEEEDPLAYYEKHTSQIEIVRLDRSMEQIIFPVPGICEFLTKETKYRLFTTTEQDE
QGSKVSDFFDQSSFLHNEMEWQKKLRSMPLMYWFSRRMTLWGSISFNLAVFINIIIAFFY
PYVEATSMGLLDSPLISLLFWILICFSIMALFTKRYGVRPLLVALILRSIYYLGIGLTLN
ILGTLNLANKIVFVVSFVGNRGTFIRGYKAMIMDVEFLYHVGYILTSVLGLFVHELFYSI
LLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLP
DSKAKDDPLGMHRNMKTFMESCSGDEISCSAVPTALEEKDADQWERACDTLLMCIVTVLN
HGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEK
QKKEEILKTTCFICGLERDKFDNKTVSFEEHITYEHNMWNYLYFIVLVRVKNKTDYTGPE
SYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRNLQDKLNTTMKLVSHLTSQLNELK
EQMTEQRKRRQRMGFVDVQNTMNH
NT seq 7995 nt   +upstreamnt  +downstreamnt
atgaacgagatgtcaagtttcctgcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggacgatcggtgcgtggtggagccc
gctgctggtgacctggacaacccacccaagaagtttcgagattgcctcttcaaagtatgt
cccatgaaccgctactctgcccagaagcagtactggaaggccaagcaaaccaagcaggac
aaggagaagatcgcggacgtggtgctgctgcagaagcttcagcatgcagcccagatggag
cagaagcagaacgacacggagaacaagaaagtgcatggcgacgtggtgaagtacggcagt
gtcatccagctcctccacatgaagagcaacaagtacctgacggtgaacaagcggctgccg
gccctgctcgagaaaaacgccatgcgggtgacgctggatgccaccggcaatgagggatcc
tggctcttcatccagcccttctggaagctgaggagcaatggagataatgtagtcgtggga
gacaaagtcatcctgaaccccgtcaacgctgggcagccgctgcacgccagcaactacgag
ctggctgacaacgccggctgcaaggaggtgaactcagtcaattgtaacaccagctggaaa
atcaaccttttcatgcagttctgcgaccacatggaggaagtgctgaaagggggggacgtg
gtgaggctcttccacgccgagcaggagaagtttctcacctgcgacgagtacaaaggcaag
ctgcacgtcttcctccgcaccaccctgaggcagtcggccacctcggccaccagctccaac
gccctgtgggaggtggaggtggtccaccacgacccgtgccgagggggagccgggcactgg
aatggcttgtaccgcttcaagcacctcgccacgggcaactacctggcagcggaggaaaac
ccaagttataaaggagacgtggctgagcccaaagcagcgcccacggggggcagcagccgc
gccagccgcaggaacacgggggagaagatcaaataccggctggtggccgtgcctcacggc
aatgacatcgcctccctcttcgagctggaccctaccacgctgcagaagacggactccttt
gtcccgcggaactcctacgtgaggctgcgccacctctgcaccaacacctggatccagagc
accaacgtgcccattgacatcgatgaggagaggcccatccgcctcatgctgggcacgtgc
cccaccaaagaagacaaagaagctttcgccatcgtctccgtgcctgtgtctgagattcgg
gacctggactttgctaacgacgccagctcgatgctggccagcgtggtggagaagatgaac
gaaggttttctgagccagaatgaccggaggttcgtgatccagctgctggaggacttggtg
tttttcgtcagcgacgtccccaacaatggccagaacgtgctggacattgtggtgaccaag
cccaaccgcgagcggcagaagctgatgcgggagcagaacatcctgaagcagatctttggg
atcctgaaagcccccttcaaggacaagggtggggaagggcccctggtgcggctggaagag
ctgtcggaccagaaaaacgctccctaccagtacatgtttcggctgtgctaccgcgtgctc
cggcattcccaagaggactatcgcaagaaccaggagcacattgccaagcagttcggcatg
atgcagtctcagatcggctacgacatcctggccgaggacaccatcacagccctgctgcac
aacaaccgcaagctgctggagaagcacatcacgaagaccgaggtggagaccttcgtcagc
ctggtgcgcaagaaccgcgagccacggtttttggactacctctcggacctgtgcgtgtcc
aaccacattgccatccccgtcacccaggagctgatctgcaagtgcgtgctggacccaaag
aacagcgacatcctcatcaaaaccgagctgaggccagtgaaggagatgtcccagacccat
gagtacctgagcatcgagtactcggaggaggaggtctggctcacctggacggacaagaac
aatgaccaccacgagaaaagcatccggcagctggcacaggaggcccgggctggcaatgcc
catgatgagaacgtcctcagctactacaggtaccagctgaagctttttgcgcgcatgtgc
ctggatcgccagtacttggccatcaaggagatctcccagcagctgggtgtggacctgatc
ttcctctgcatggcagatgagatgctgcccttcgatctccgagcctccttctgccacctc
atgttacacgtgcacgtggacagggatccccaggagctggtgatgcccgtgaagtttgca
cggctctggaccgagatccccacagccatcaccatcaaagactatgactccaacctcaat
gtctcgcgcgatgacaagaagaacaagtttgcaagcaccatggagttcgtggaggactac
ctcaacaacgtggtgagcgaggcggtgcccttcgccaacgaggagaagaacaagctcacc
ttcgaggttgtcagccttgcccacaacctcatctacttcggcttctacagcttcagtgag
ctgctgcgcctgacgcggacgctgcttggcatcattgactgtgtccaaaacccccagctg
atgatgcaggcagtctacaacgacgaggtgacggggaagaacgtgcggaggtcgatccag
ggcgttgggcagatgatgtccaccatggtgctgagcaggaaacagtccatcttcagccct
ccaagcctcagtgccgggtctgccccagagcaagtggacagagggaggagcattgagaac
gagaacattgtggtgatggagaccaagctgaagatcttggagatcttgcagttcatcctg
aacgtgcggctggactacaggatttcctacctgctttccgtcttcaagaaggagtttgtg
gaagtctaccccatgcaggacagcgcagccgacgggacggctccagcctttgactccaca
actgcagccatgaacctggaccggatcggcgagcacgcagaagccatgttcggtgtgggg
aagacgagcagcatgttagaggtggatgacgagggagggaggatgtttctgcgggtgctg
atccacctgacgatgcacgactacccgccactcatctccggctccctgcagctcctcttc
aagcacttcagccagaggcaggaggtcttgcacaccttcaaacaggttcagctcctgatc
tcagcccaggatgttgagaactacaaggtgatcaagtcagagctggacaaactccgcact
atggtggagaaatcggagctctgggtggacaagaagggcagcagcaaaggggacagcacg
gtggaggggaacaagaaggagaagaaagagcatgctgccgacgaagaggtcattgctccg
ggagagaagagcagcgagaactatcagatagtcaaggggatcctggagcggctgaataag
atgtgcggggtcggagagcaagtgcgcaagaagcagcagcgccttctgaagaacatggat
gctcacaaagtgatgctggatctgctgcagatcccttatgagaagggtgatgccaagatg
atggagatcctgaaattcacccaccagttcctgcagaagttttgtgctggcaatcaggaa
aaccaggccctgctgcacaaacacctcaacctgtttctgaccccggggctcctggaggct
gagacgatgcagcacatcttcctcaacaactaccagctctgctcagagatcaatgagacg
gtgccgcagcacttcatccactgcgtggccacccacggccgccacgtgcagtacctcgac
ttcctacacaccatcatcaaggccgagggcaagtacgtcaagaagtgccaggacatgatc
atgacggagctcaccaatgctggggacgatgtggtggttttctacaatgacaaggcttca
ctggccaccctcctggagatgatgacagcggccagggatggggtggaggagaacagcccg
ctgatgtaccacatctcgctggtggacttgctggctgcctgcgccgagggcaagaacgtc
tacacagagatcaagtgcacgtccctgctgcccttggaggatgtggtgcgggtggtgaca
catgaggattgcatcacggaggtgaagatggcctacgtgaactttgtcaaccactgctac
gtggacacggaggtggagatgaaggagatctacaccagcaaccacatctggactctcttt
gagaatttcaccctggacatggcccagatgtgcaagaagcgagagaaacgcctgccagac
cctacgctggagaagtacgtgctgacggtggtgctggacaccatcaacgcgttcttcagc
tcccccttctcagagaacagcacctcgctgcagacccaccagaccattgtggtgcagctt
ctccagtccaccatgaggctgctggagtgcccctggctgcagcagcagcacaagagctcg
gtggaagcctgcatccgcacgctggccatggtcgccaagagccgctccattgcgctaccc
atggacctggatgcccacgtcagctccctgctcaacagcagctccaccaacactgtgcag
aggaatacgtccaactacaagacagccacacggaccttcccccgtgtctccaccaccccc
aaccagtgggactacaagaatatcatagagaagctgcaggacatcatcagcgccctggag
gatcgcttgaaaccactggtggaggctgagctgtctgtcctggtggatgtcctccaccgg
ccagagctgcttttcatggaggggacagaggcgtttcagcgatgcgagagcggaggtttc
ctgtccaagctggtgcagcacaccaaggacctcatggagacggaagagaagctgtgcatc
aaggtgctgaggacgttgcagcagatgctggtgaagaggaacaagtacggcgagaggggc
aacctgctgcggaaaatgctcctgaacaattacctgcagaacaagaagtccagctccaaa
ggcgaaatcatggatgctgctgggggaggccaagaccaggactggtccgccattgctgct
gtccagtgccggctggaccgagaaggggccaccaagttggtggctgacctcatcatgaac
accaagaacgagaagatcttccaagagagcatcctgcttgccatccggcttctggacgga
ggcaacactgagatccagaaatccttttacaacctcatgacaagtgacaagaagtctgag
aagttcttcaaagttttgcacgaccggatgaagaaggcgcagcaggagaccaagtctacg
gtgtctgtgaacatgagtgacattgggaacaagcctcgtgaggacaaagacgagcctgac
cctggcaccaaaggacgaggagacacctttgtgatgcccggcaccccttcccgatacccg
atggctgttgggtttcggaagggccatgacaccggggagcagggtcagaacaacgaaatg
ggggtgacggtcctgatcatggagcctatcctgcgattcctgcagctgctctgcgagaac
cacaaccgggacctgcagaacttcctccggtgccagaacaacaagaccaactacaacctg
gtgtgcgagacgctgcagttcctcgacatcatgtgtggcagcaccacgggggggctgggg
ctgctgggcctctacatcaacgagtacaacgtggccctcatcacccagaccctggagacc
ctgaccgagtactgccaagggccctgccacgagaaccagagctgcatcgtgacccacgag
tccaatgggattgacatcatcacagccctcatccttaatgacatcagccccctctgcaag
taccggatggacctggtcctgcagctgaaggacaatgcctccaagctcctcttggccctc
atggagagcagacatgacagcgaaaatgctgagcggatcctcatcagcctccgcccacag
gaactggtcgacgtgattaagaaggcctatctgcaggaggaggagtgtgaaaacgccgag
gtttccccccgggaagtcggccacaacatttatatactggcactgcagctgtcccgacac
aaccggtctctgcagcagctcctgaagccggtgaagcgaatccaggaggaggaggaggag
ggtatctcgtccatgctcagcctaaataacaagcagctgacgcagatgctgaagtcgacg
gccccggtccaggaggaagaggaggacccgctggcgtattatgagaaacacacgtcccaa
attgagattgtgcgcctggaccggagcatggagcagatcatcttccccgtgcctggcatc
tgtgagttcctcaccaaggagaccaagtaccgcctcttcaccaccacggagcaggacgag
cagggcagcaaagtcagtgatttctttgaccagtcgtccttcctccacaacgagatggag
tggcagaagaaactgcgcagcatgccgctgatgtactggttctcccgcagaatgacgctc
tggggaagcatttccttcaacctggctgtcttcatcaacataatcattgctttcttctac
ccctatgttgaagccacttccatgggactgttggattcccccctgatctcgctgctcttc
tggattctgatctgcttctccatcatggccttgtttactaagcgctacggtgtcagaccg
ctcctggtggcactgatcttgcgatcgatttattacttggggattggactcactctgaac
atactgggaactctcaatctggccaacaagattgtgtttgtggtgagcttcgtgggcaat
cgcgggaccttcatccgaggctacaaggccatgatcatggatgtggaatttctttaccac
gttggctacatcctgacgagcgtcctgggactctttgtgcacgaactcttctacagcatc
ctgctgtttgacttgatctaccgtgaggagaccttgtttaatgtcatcaaaagcgtgacg
cggaacgggcgctccatcctgctgaccgccctcctggccctcatcctcgtctacctcttc
tccatcgtgggcttcctgttcctgaaggatgacttcatcctggaggtggaccggctgccg
gacagcaaagccaaagatgaccccttggggatgcacaggaacatgaagaccttcatggag
tcatgcagcggtgacgaaattagctgctctgctgtgcccactgccttggaagaaaaagac
gcggaccagtgggaacgtgcctgcgacacgctgctcatgtgcatcgtcactgtcctgaac
cacggcctgaggaacggcgggggcgtgggtgacattctgcggaagccatcgaaggatgag
tccttgtttcctgcccgagttgtctatgacctcctcttcttcttcattgtcattatcatc
gtccttaacctcatctttggggtcattattgacacttttgctgatctgaggagcgagaag
caaaagaaggaagagatactgaagaccacctgtttcatatgcgggctcgaaagggacaag
tttgacaacaagacggtgtcctttgaggagcacattacatacgagcacaacatgtggaac
tacttgtacttcatagtgctggtgcgagtgaagaacaagacggactacaccgggccggag
agttacgtggcgcagatgataaagaataagaaccttgactggttcccccgcatgcgcgcc
atgtcgctggtcagcaacgaaggggaaggggaacagaatgagatccgaaatcttcaagac
aaactcaataccacgatgaagctggtgtcccatctcacctcccagctgaatgagctgaag
gaacagatgacagagcaacggaagcgcagacagaggatggggtttgtggatgtccagaat
accatgaaccactaa

KEGG   Nipponia nippon (crested ibis): 104016945
Entry
104016945         CDS       T05756                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04020  Calcium signaling pathway
nni04070  Phosphatidylinositol signaling system
nni04114  Oocyte meiosis
nni04140  Autophagy - animal
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04621  NOD-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104016945 (ITPR1)
   04020 Calcium signaling pathway
    104016945 (ITPR1)
   04070 Phosphatidylinositol signaling system
    104016945 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104016945 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104016945 (ITPR1)
   04210 Apoptosis
    104016945 (ITPR1)
   04218 Cellular senescence
    104016945 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104016945 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104016945 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    104016945 (ITPR1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104016945 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104016945 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104016945 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104016945 (ITPR1)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104016945 (ITPR1)
Ion channels [BR:nni04040]
 Ligand-gated channels
  IP3 receptor
   104016945 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans Plk4_PB2
Other DBs
NCBI-GeneID: 104016945
NCBI-ProteinID: XP_009468185
LinkDB
Position
Unknown
AA seq 2734 aa
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAELDPEQDASRRGLRSAQEKMAYSLVSVPEGNDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPANADILIETKLVLSRF
EFEEVSSGENALEVGEDEEEVWLFWRDSNKEIRSKSIRELAQDAKEGQKEDRDVLSYYRY
QLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQ
EQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFS
DKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHITTIFPITKMAKGEES
KGSNVMRSIHGVGELMTQVVLRGGGFLPMTPLAAAPEGNVKQSEPEKEDILVMDTKLKII
EILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPTGSSNQEMPANVPGALDFEHIEE
QAEGIFGGRKENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQ
AFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEAMDGVQGENEHKKK
EEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQESASVRKSRKQQQRLLRNMGAHAVVL
ELLQIPYEKAEDTRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQH
IFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMVMAELV
NAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIK
CNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLV
DICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGV
FRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHNIVQKTAMN
WRMTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVLVDVLHRPELL
FPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKDRGYGEKLVSI
TIELDNAELPQPPETESSVEELDQSLPQRQLEDHRRGEALRQVLVNRYYGNVRPAGRRES
LTTFGNGPLSAGGASKAGAGGGSSGSSSMSRGEMSLADVQCHLDKEGASNLVIDLIMNAT
SDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVT
VNTSDLGNKKKDEDSDRDVPSRKRVREPMTQITEEVRDQLLEASAATRKAYNTYRREADP
DDHYSAGEGAQSAADKSKDDLEMSAVISIMQPILRFLQLLCENHNRDLQNFLRCQNNKTN
YNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQNCIA
THESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNM
RPKELVEVIKKAYLQGEIEFEDGENGEDLAASPRNVGHNIYILAHQLARHNKELQNMLKP
GGQIEGDEALEFYAKHTAQIEIVRSDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQ
GSKINDFFMKSEDLFNEMNWQKKLRAQPFLYWCARNMSFWSSISFNLAVLMNLLVAFFYP
FKGIRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFL
LGAFNVCNKIIFLMSFVGNCGTFTRGYKAMIMDVEFLYHLLYLLICALGLFVHEFFYSLL
LFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDDFILEVDKLPN
ETLLPEPGETMTGEFLYSDVCKAGGSENCSSIIPSDQLIAEEMEEENKEHTCETLLMCIV
TVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADL
RSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEY
TGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQL
SELKDQMTEQRKQKQRIGLLGHPPPMNVNPQQPA
NT seq 8205 nt   +upstreamnt  +downstreamnt
atgactgacaagatgtcgagcttccttcatattggagatatttgttctctctatgcagag
ggctcaacgaatggatttattagcactttgggccttgtggatgatcggtgtgttgtacag
ccagaagcaggtgatcttaacaacccacccaaaaaatttagagattgcctgttcaaacta
tgtcccatgaaccggtactctgctcaaaagcagttctggaaagcagcaaagccaggagct
aacagcacaacagatgccgtgctactcaataaactgcaccatgcagcagatttggaaaag
aaacagaatgaaactgaaaacagaaagctgctgggaacagtcatccagtatggcaatgtt
atccagctgcttcacttaaaaagtaacaaatacttaacagtaaataagaggcttccagct
ctactagagaagaatgctatgagggtgaccttggatgaagctggaaatgaaggttcctgg
ttctacatacagcccttctacaaactgcgttccattggagacagcgttgtcattggagac
aaagtagtcctgaatcctgtcaatgctggccagcctctccacgccagtagtcatcagctt
gtcgataatccgggatgcaatgaggtcaactctgtgaattgcaatacaagctggaaaata
gtcctcttcatgaaatggagtgataacaaagatgatattctcaaagggggggatgtggtg
agactgtttcatgcagaacaggagaagtttctgacttgtgatgagcacaggaagaagcag
catgtcttcctgagaacgacagggagacagtcggccacatctgcaaccagttcaaaagcc
ctgtgggaagtagaggtggtgcagcatgatccttgtcgtggtggtgcggggtactggaat
agccttttcaggttcaaacaccttgctactggacactacctagcagcagagctggaccct
gagcaggatgcctccagaagaggcttgcgcagtgctcaggagaagatggcgtactctctg
gtgtctgtgcctgaaggaaatgatatctcctccatatttgagttggaccctacgaccttg
agaggaggagacagccttgtccccaggaactcttatgtcagacttagacacctttgcact
aacacctgggttcatagtaccaatatccctattgataaagaagaagagaaacctgtgatg
cttaaaattggtacttctccagtgaaagaggacaaagaagcttttgctatagtaccagtt
tcccctgcagaagttcgggacttggattttgcaaatgatgcaagtaaggttttaggttcc
attgctggcaagttggaaaagggaacgataacccagaatgaaagaagatctgttaccaaa
ttgttggaggatttggtctactttgttaccggtggaactaattctggacaagacgtcctt
gaagtggtattttctaaacctaatagagaacggcaaaaattgatgagagaacagaatatt
ctaaagcagattttcaagttgttgcaagcaccatttacggacagtggtgatggcccgatg
ttgcggttggaggagcttggagaccagcgtcatgctcctttcagacacatatgccggctt
tgctacagagtgctgagacactctcagcaggattacagaaagaatcaggaatacattgcg
aagcagtttggcttcatgcagaagcaaattggctatgatgtcttggccgaggacactatt
acagcactgcttcataacaatcgcaagctcttggagaagcacatcacagctgctgagatt
gacacttttgttagtctcgtgaggaaaaatagggagcccaggtttttggattacctctcg
gatctgtgcgtttccatgaacaagtctattccagtgacgcaggagttgatttgtaaagct
gtgctgaatccagcaaatgcagacattctcattgaaactaagctggtcctctctcgattt
gagtttgaagaagtgtcaagtggagaaaatgccttggaagttggagaagatgaggaagaa
gtgtggttgttctggagagacagtaacaaggaaatccgcagtaagagtatcagagagttg
gctcaggatgctaaggaagggcagaaggaagatcgggacgtactcagctactacagatat
caactaaacctctttgctagaatgtgccttgatcgacagtacttagccataaatgaaata
tctggccagctggatgtggacctcattctccgttgcatgtctgatgaaaacttgccatat
gatctgagagcgtctttctgccggctaatgcttcatatgcacgttgatcgtgacccccaa
gaacaagtaacgccagtgaagtatgctcgtctgtggtctgaaataccttctgaaattgct
attgatgactatgatagcagtggaacttccaaagatgaaattaaggagagatttgcacaa
acaatggaatttgtagaggaatatttaagagatgtggtgtgtcagaggttccctttctct
gataaagagaaaaataagctcacttttgaggttgttaacttagccagaaatctgatatat
tttggtttctacaacttctgtgacctcctcagactaaccaaaatcctccttgctatatta
gactgtgtgcacatcactactatcttccctattaccaagatggcaaaaggcgaggaaagt
aaagggagcaatgtgatgagatcaatccacggagtcggtgagctgatgacccaggtggtg
ctcagaggcggcgggttcttgcccatgactccgcttgctgctgctcctgagggtaacgtc
aagcagagtgaaccagagaaagaggacatcctggtaatggacacaaagctgaagatcatt
gaaatacttcagtttattttgaatgtgagattggactacagaatctcctgcctactttgt
atattcaaacacgaatttgatgaaagtaatgcccagatgtctgaatcgcccactggaagc
agtaatcaagaaatgccagctaacgtaccaggagccctagactttgaacatattgaagaa
caagccgaggggatatttggcggaaggaaagagaacacaccactggatttggatgatcat
ggtggcagaacttttctcagagttctgttgcatttaacaatgcatgattatcctcctctg
gtgtctggagcacttcagctactcttccggcactttagtcagagacaagaagtccttcaa
gcttttaagcaggttcaactgcttgttaccagccaagatgttgacaactacaagcagata
aaacaagatttggaccagctgaggtctattgtggaaaaatcagagctttgggtgtacaaa
ggccaaggtcctgatgaggctatggatggagtgcaaggtgaaaatgaacacaagaaaaaa
gaggaaggtcacagcaagtcccaaaagcctgaaagtactagcagctacaactaccgtgta
gtaaaagagatcctgctgcggctcagcaagctctgtgttcaggaaagcgcctcggtcagg
aaaagccgtaagcagcagcagcgtcttctgaggaacatgggagctcacgcggttgtgctg
gagctgctgcagatcccttatgaaaaggctgaagacacgaggatgcaggagataatgaag
cttgcacacgaatttttacagaacttttgtgctgggaaccaacagaaccaggcattgctg
cacaagcacataaacctgttccttaacccagggattctggaagcagtaacaatgcagcac
attttcatgaacaacttccagctttgcagtgagattaatgaacgcgttgttcaacacttt
gtccactgtatcgaaacacatggcagaaatgttcagtacataaagttcctgcagacaatt
gtcaaggcggaaggaaaattcattaagaaatgccaagatatggtaatggctgagctggtg
aatgcgggagaagacgtcctagtgttttacaatgacagagcctccttccagactttggtg
caaatgatgagatcagagagagatcggatggatgaaaacagcccgctgatgtaccacatc
cacttagtagaactgcttgctgtgtgcacagaaggcaaaaatgtctacacagaaataaaa
tgcaactcccttcttcctttggatgacattgttagggtagtaacccacgaggattgcata
cctgaggtcaaaattgcgtacatcaacttcttgaatcattgctatgtggacacagaagta
gaaatgaaagagatttacaccagtaatcatatgtggaagctatttgagaacttcctggtt
gacatctgtcgggcttgtaacaacaccagcgacagaaagcatgctgactccatattggag
aagtacgttacagaaatagtgatgagtatagtcaccactttcttcagttccccattctct
gatcagagcactactttgcagactcgccagcctgtgtttgtacagttactgcaaggcgtg
ttcagagtgtaccattgcaactggttaatgccaagccaaaaggcatcagtggaaagctgc
attcgggtcctctcagatgtagcaaaaagccgtgcaattgcaattcctgtagacttggac
agtcaggtcaacaatctcttcctgaaatctcataacatcgtgcagaagactgcaatgaac
tggcgaatgactgcaaggaatgctgcccgcagagattcagtgctcgctgcctccagggat
tatcgaaacataattgaaagattacaggacatagtatcagctttagaggatcgcctacgt
cctcttgtccaggcagagttatcagtactggtagatgtgcttcacaggcctgaactgctc
ttcccggagaacacagatgcaaggaggaaatgtgaaagtggaggtttcatttgcaagtta
ataaagcatactaaacagctgctagaggagaatgaggagaaactatgtattaaagtatta
cagacgctcagggaaatgatgaccaaagatagaggctatggagaaaagctcgtttctatt
accattgaattggataatgctgagctgccgcaacctccagaaacggaaagctctgtagag
gagcttgatcaaagtctaccacagaggcaactggaggatcatagaaggggtgaggcactc
aggcaagttttggtcaaccgttactacggcaatgtgagaccggcgggacggcgcgagagc
ctcaccaccttcggcaatggccccttgtctgccggaggcgccagcaaagccggggcagga
ggaggaagctctggatcgagttcaatgagccgaggtgagatgagtttggcagatgtccag
tgtcatctggataaagaaggtgcatccaacctggtcatagatctcatcatgaatgccacc
agtgacagagtcttccatgagagcatcctgctagccattgcccttctggaaggtgggaac
actacaatacagcattcgttcttctgccgactgacggaagataagaaatctgaaaagttc
tttaaggttttttatgatcgcatgaaagtggcacagcaagaaatcaaggctactgtcaca
gtcaatactagtgacttaggaaataaaaagaaagatgaagactcagacagagatgtaccg
agcaggaaaagagtgagagagcctatgacccaaattaccgaggaggtgcgagatcagtta
ctggaggcctctgcagctacaagaaaggcttacaacacttaccggagggaggctgatcct
gatgaccattattcggcaggagaaggagcacagtctgcggcagacaagagcaaagatgac
ctggagatgagtgctgtgatctcaataatgcaacccatcctccggttcttgcagctgctc
tgcgaaaaccacaatcgggatttgcagaatttccttcgctgccagaacaataagacaaac
tacaacttggtgtgtgagacactgcagtttctggactgtatctgtggaagcacaactggt
ggacttggacttcttggtctgtatataaatgagaaaaacgtagcgctgatcaaccagaca
ctggaaagtttgaccgaatactgtcaggggccttgccacgagaaccagaactgcattgct
actcacgagtccaacggtattgacatcatcacagcattaattctcaatgacatcaaccct
ttgggaaagaagaggatggaccttgtgttggaactgaagaacaatgcttcaaaactgctc
ttggcgatcatggagagcaggcacgacagcgagaacgcagagaggattctctacaacatg
aggcccaaagagctggtggaagtgataaagaaggcttatctgcaaggagaaatagaattc
gaagatggagaaaacggggaagatcttgcggcatctccgaggaacgtgggacacaacatt
tatatattagctcatcagttggctcgtcataacaaagagctgcagaacatgctgaagccg
ggaggtcagatagagggagacgaggctctggagttttatgccaagcacacggcacagatt
gagattgtcaggtcggaccgtaccatggagcaaatagtgttccctgtgcccagtatctgt
gaattcctcacgaaggagtccaagctgcggatatattataccacggagagggatgaacaa
ggcagcaagatcaatgacttcttcatgaaatcagaagacctctttaatgagatgaactgg
caaaagaaattgcgagctcaacctttcctatactggtgtgctcgcaacatgtccttctgg
agcagtatttcctttaacctggctgtccttatgaacctgctcgtagcatttttctatcca
ttcaaaggaattcgaggaggtacactggagccccactggtcaggcttgctgtggacagct
atgctgatatctctggctatcgttatagctcttcctaagccccatggcatccgagcctta
attgcttctacaatattacgactaatattttcagttggtttacaacctactttatttctt
ctgggtgcattcaacgtttgtaataaaatcatttttctgatgagttttgtgggaaactgt
ggaaccttcaccagaggatacaaggcaatgatcatggatgtagagtttctttatcacctg
ctgtaccttctgatttgtgctctggggctcttcgtacatgaattcttttatagtttgttg
ctctttgatttggtgtatcgagaagagaccttgctgaacgtcatcaagagcgtcactcgc
aatgggcgttccatcatcctgactgctgttcttgctcttatcttggtctacctgttctcc
atagtggggtacctcttcttcaaagatgactttatcctggaagtagacaagctccctaac
gaaacgctattgccagaaccaggtgagaccatgaccggagagtttctctattcagatgta
tgcaaagcaggtggcagtgaaaactgttcttcgatcattccttcagaccaactgattgct
gaagaaatggaggaagagaataaagagcatacgtgcgagacgttactgatgtgcattgtt
actgtactgagtcatgggctcaggagtgggggtggagtaggtgatgtgctcaggaaacca
tccaaagaggaacctctctttgctgctagagtgatatatgatctgttattcttcttcatg
gtcatcattattgtccttaacctgatttttggtgtgatcattgacacttttgctgattta
aggagtgaaaaacagaagaaagaagaaattttaaaaactacttgctttatttgtggtttg
gaaagagataaatttgataacaagacagtcacatttgaagagcacattaaagaagagcac
aatatgtggcattatttgtgctttattgtgttagtgaaagtaaaagattcaacagaatac
acaggaccagaaagttatgtggcagaaatgatcaaggagagaaacctggactggttcccc
cggatgcgggccatgtcacttgtgagcagcgactcagaaggggagcagaatgagctgagg
aacttgcaggagaagttggagtccaccatgaagcttgtgaccaacctctctggccagctg
tcggagcttaaagatcagatgacggagcagaggaagcagaaacagcgcattggtctccta
ggacaccctccgcccatgaatgtgaacccgcagcaaccggcataa

DBGET integrated database retrieval system