KEGG   Nipponia nippon (crested ibis): 104012701Help
Entry
104012701         CDS       T05756                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00500  Starch and sucrose metabolism
nni01100  Metabolic pathways
nni04910  Insulin signaling pathway
Module
nni_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104012701 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104012701 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nni01003]
    104012701 (GYS2)
Enzymes [BR:nni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104012701 (GYS2)
Glycosyltransferases [BR:nni01003]
 Polysaccharide
  Storage polysaccharide
   104012701 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 104012701
NCBI-ProteinID: XP_009463367
UniProt: A0A091V2M1
LinkDB All DBs
Position
Unknown
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLPQWEDEDLPVEDLLLFEVSWEVANKVGGIYTVIQTKAKITADEWG
ENYFLVGPYFEHNVKTQVEACEPPNPAVKKAMDTMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGEFWDVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAIEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLNKI
FDRDDITIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVSDPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSEG
EDEDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgacttctcttaacgggcttcctcagtgggaagat
gaagacctgccagtggaggatttgttgctctttgaagtttcttgggaagttgccaacaaa
gtgggaggcatttacaccgtgatccagacaaaagccaaaattacggcagatgaatggggt
gaaaactattttctggttggtccctattttgagcacaacgtgaagactcaggtggaagca
tgtgagcctccaaaccccgcagttaagaaggcaatggacaccatgaaaagccaagggtgc
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactgtttgatata
ggatcagcagcctggaatctggacaagtggaaaggcgaattttgggatgtcagcaacata
gggatcccttttcatgaccgagaagccaatgatgctgtgatttttggttcgttaacagcc
tggtttttaaaagagctttcctgtcagtttgatgacaagcccaacataattgcccacttc
catgagtggcaggcaggagtgggtttaatactgtctcgatctcagaaacttcctgttgcc
acaatttttactacccatgcaactctgcttgggagatacctgtgtgcagccagtatagat
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcggtactgtatggaacgggcatctgtacattgtgcccatgtgttcaccacagtctca
cagataacagctatagaagcagaacatatgcttaaaagaaatcctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcaat
cttgagaaaaccttatttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcataagactgat
gttacagttgttgtgttcttcatcatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaagggcaagcagtccggaagcagctctgggacactgcacagtctgtgaaagaaaag
tttggaaagaaactctacaatgccctgctaaaaggagaaattccagacttgaacaagatt
tttgaccgagatgatataaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgcctccagtgaccactcacaacatgattgacgatggcaatgatccaatcctcaatacc
atccgacgcattggccttttcaataaccggacagacagagtaaaggtgatcctgcatcca
gagtttctttcttcaacaagcccattgctgcccttggactatgaggagtttgttagaggc
tgccaccttggtgtatttccgtcttactatgaaccctggggttacacgccagctgaatgt
actgtgatgggcattcccagtgtaaccacaaacctttctggattcggctgtttcatgcag
gaacatgtttctgacccagcagcttatggcatctacatagttgacaggaggttccgctca
cctgatgaatcatgcaaccagctgactcagttcctgtacggattttgtcagcagtcccgt
cgccagaggatcatccaaagaaacagaactgagagactctcagatctgttggactggaga
tacctaggcaggtattacatgcacgccagacacctggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcagtgccaccatcaccttctgtctctcagcattccagccctcaccatagcgaaggc
gaagatgaagatgaggatgaaagatatgatgaggatgaggaagccgaaagggataggcaa
aacatcaagtctcccttttcccttggagtattgccgcaagggaaaaagaagcagcatgga
gaatacaggaactga

DBGET integrated database retrieval system