KEGG   Nipponia nippon (crested ibis): 104013097
Entry
104013097         CDS       T05756                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04370  VEGF signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104013097 (NFATC2)
   04370 VEGF signaling pathway
    104013097 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104013097 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104013097 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104013097 (NFATC2)
Transcription factors [BR:nni03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104013097 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 104013097
NCBI-ProteinID: XP_009463830
LinkDB
Position
Unknown
AA seq 970 aa
MQRETACRLVHYHHIMRSMDQEEPTPHKTNSPPSGVTYAHDVLDCGLKPCPLPFSSLSAD
PMGRYGQPDSIGTTPTHPANAAGASAPSPRIEITPYHELIHSGGPFRSKDTDVLLVEHQS
NSATASPRVTLPVPGFEGYREPLCLSPASSGSSASFISETNVSPCTSPCVSPNNGPSDDL
CPQFQNIHTHYSPRTSPIMSPRTSITEETCLGRHSPSPCPNSRSSSPGAKRRYSCTELYS
TQLPSTSPRQSRTPSPQSSPRIPLREDNSSVTYTQLPSASLSMDAMNSLPTDPSCGVPTK
IWKTSPDPSSMPSHKNSIPCHVFQTVDFHGPCEQEDRRNSAPESILLVPPSWTKQLVPAI
PICSLPVQSLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQ
LHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIIGNTKVLEIPLE
PKNNMKATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESNGRIISLQAAS
NPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESKVVFTEKTSDGQQIWEM
EATVDKDKSQPSMLFVEVPEYRNKHIRTAVKVNFYVINGKRKRSQPQHFTYHPVPSIKTE
PIDDYDPALICNTVHSGLGTVTQPYYSQHTMVTESPSCLVATMAPCQQLRSGLSSPDSRY
HQQNPAAVIYQRSKSLSPSQLGYQQSNLMATPVAISDAHRSVLVHAGSPGQTSAVLHHSP
GNQQSSPVIHYSPTNQQLRCGSHQEFQHIMCCENFTSNVARSSQPQVSQAQRLSPSSYPT
VIQQQTASGQRAAKNGPPVNDQKEVLPAGVTIKQEQNLDQAYLDDVWSLQEEINAKLIVQ
LDAAIIKASSKTDIDFSASRLKQSVCFGQGQPGEPTSTSDAQARLADAPQEPLAQGSVGS
DGDGAGSEKQ
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgcagagagaaactgcctgcaggctggtacattaccaccacatcatgaggtctatggat
caagaagaaccgactccacataaaaccaacagcccaccctctggagttacatacgctcat
gatgtcttggactgtggcctcaagccatgccccctgcctttttctagcctttctgcagat
cccatgggcagatatggacagccagatagcatagggacaacacctacacaccctgccaac
gctgcaggggcctctgctccaagccctaggattgaaattactccatatcatgaactgatt
cattcagggggtcccttccgcagcaaagacacagatgttcttttggtagaacatcagtca
aactcagctactgctagcccaagggttaccctgcctgtccctggctttgagggctacaga
gaaccactgtgtttgagcccagctagtagcggctcctctgcaagtttcatttcagagaca
aatgtatctccttgcacatcaccatgtgtttcaccaaataatggtcctagtgatgacctt
tgtccacagtttcaaaacatccatactcattattctcctagaacctctccaataatgtca
ccacgaacaagcatcacggaggaaacctgcttgggacgacattcaccatcaccctgtccc
aactcaaggtcttcatcaccaggtgcaaaacggaggtactcttgcactgagctctacagt
actcagctgccttccacttctccacgacagtcaaggaccccctctccacaatcctctcct
cgcatccccttgagagaagacaactcttcagttacttacacgcagttgcccagcgcttct
ctttccatggatgctatgaacagccttcctacggatccttcctgtggcgttcccacgaaa
atttggaaaaccagccctgatccttcatcaatgccttcccacaaaaacagcattccatgt
cacgtctttcagactgttgacttccacgggccttgcgagcaggaggacaggagaaactca
gccccggaatcaattttgttggtacctccatcctggacaaagcaactggtgcctgcaata
cctatctgcagtttgcccgtccagtcgctcccgcccctcgagtggccactctccagccag
tcgggctcctacgagttgcggatcgaggtacagccgaagccccaccaccgggcgcactac
gagacggagggaagccgaggggctgtcaaggcaccaaccggaggccaccccgttgtccag
cttcacggttacatggagaacaaacccttgggtcttcagatcttcattgggacagcagac
gaacggatacttaaacctcacgccttctatcaagtccatcgcattacgggaaaaactgtc
accaccaccagctacgaaaaaatcattggcaacaccaaagttttagagatcccactggaa
cccaaaaacaacatgaaagcaaccattgactgcgcagggattttgaagctgaggaatgca
gacatcgagctgcgcaagggagagacagacatcggcaggaagaacacccgtgtccggctc
gtcttccgcgtgcacatccccgagtccaacggcaggatcatttctctgcaagcagcatcg
aaccccatcgaatgctcccaaaggtctgctcatgaacttccaatggttgaaagacaagat
attgatagctgccttgtttatggaggacaacagatgatcctgaccggacagaatttcaca
gcagagtccaaggtggtgttcacagagaaaacatcagatgggcagcagatctgggaaatg
gaggcaacagtggacaaagataagagccagcctagcatgctttttgtagaagtaccagaa
taccgtaataagcacattcgcacagctgtgaaggtgaatttttacgtcatcaatgggaaa
agaaaaagaagccaaccccagcattttacctatcacccagtaccatcaatcaaaacagag
cccattgatgactatgatccagccttaatctgcaatacagtacacagtggtctgggaaca
gtaacacagccttactattcacagcatacaatggtcaccgaatccccttcctgtcttgtg
gccactatggctccttgccagcagttgcgctcaggcctttcttctcctgattctcgatac
catcagcagaatccagccgctgtaatataccaaagaagcaagagccttagcccgagccaa
ctgggctaccagcaatccaatttgatggctacaccggttgctatttcagatgcccatagg
tcagtgctggtgcacgctggttctccaggccaaacttcagcggtgctccaccactctcca
ggcaaccagcagtcttctccagtgattcactattctccaaccaaccagcagctgaggtgt
ggaagtcaccaagagtttcagcacatcatgtgctgtgaaaattttacgtccaatgttgca
agatccagccagccccaggtcagtcaagcacaaaggttaagtccgagttcatatcctacc
gtgattcagcagcagacagcctcaggccagagagcagcaaaaaatggaccaccagttaac
gaccagaaagaagtgttaccagctggagtcactattaaacaggaacagaatctggaccaa
gcatatttggatgacgtatggtccttgcaagaggaaattaatgcgaagttaatagtgcag
ctggacgctgcaatcataaaggccagtagcaaaaccgacattgactttagtgcgagcaga
ttgaagcaatccgtgtgcttcggacaggggcagccaggtgagccgaccagcacgtcggat
gcacaagctcgactggctgatgctccccaggagcccctcgcccagggctcggtggggagc
gacggggatggggctggcagcgagaagcagtga

KEGG   Nipponia nippon (crested ibis): 104016462
Entry
104016462         CDS       T05756                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104016462 (NFATC3)
   04310 Wnt signaling pathway
    104016462 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104016462 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104016462 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104016462 (NFATC3)
Transcription factors [BR:nni03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104016462 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 104016462
NCBI-ProteinID: XP_009467631
LinkDB
Position
Unknown
AA seq 1079 aa
MPCGVRMTVEFKMSEMIKSRQSLDLESDDCASIYIFNVDQPSSSVNQPICIPRHGLQSHS
SPLSPPTRLQSHKNYEGTCEAPESKYSPLGGPKPFECPSIQITSISPNCHQGIEANEDEL
HTNGTENEYMERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESISHVYDD
VDSELNEAAARFTLGSPLASPGGSPRGPSDESWQQPYGFGHALSPRQSPCHSPRTSITDE
NWLSPRPTSRPSSRPTSPCGKRRHSSAEICYAGSLSPHHSPTPSPGHSPRGSITEDTWLN
TSIHNVQGLNSGLSPFQCCTETDIPLKTRKTSEDQTATLSGKIDICPEEQGNLSTSLETA
VDDCSGSQHTLKKDLPGDQFLSVPSHFTWNKPKPGHTPIFRTSSLPPLDWPLPSHYGQCE
LKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPVNLQMFIGTADDRYLRP
HAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRK
GETDIGRKNTRVRLVFRVHIPQPSGKVLSLQTASIPVECSQRSAQELPQIEKYSINSCSV
NGGHEMVVTGSNFLPESKIIFFEKGQDGRPQWEVEGKIIREKCQGANIILEVPPYHNKTI
TAAVQVQFYLCNGKRKKSQSQRFTYTPVIMKQEHRDEVDLSAVPSLALPHTSNVQGLHSI
RTQLPSPEQGHPHDNLLSTSPRSLVCPVQPPYTAMVTSAVPHLPHMQGRNLSPSEECHVL
PPAVVQSFQVTSAPPVRPSYQPMQSNDVYNGQSGLPVNSASSQGFDTISFQQDTAVPHLI
NLSCQALPPMQFHSSNPGSVSTPSAAGHPLAHPAHSGQSSAHLPSMGYHCPSAGQGSIPS
AMGQSLGQSSPQLQQVPYHSTNPASASSPSPTASHPLVHSPLSGPSSPQLQPMPYQSPSS
GPASSPPPTTVSHSGQHSPQARSPALGGLNAASSLVHHPVCDSSPFSPDGAAINIKPEPE
DRELNFQTIGLQDITLDDVNEIIGRDMSQISVSHGTTVASQSARTCPGSLETRISDGIQ
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgccatgtggggttcgaatgacagtggaatttaagatgagtgaaatgatcaaatctaga
caatcccttgatcttgagtctgatgactgtgcgtccatatacatctttaatgtggaccaa
ccatcatcctctgtaaatcagccaatttgtattcctcgccatggattgcagtctcactcc
tctcctctgtcaccacctacaagacttcagagtcataagaactatgaaggaacttgtgag
gcaccagaatccaaatatagtccactaggtggacccaaaccctttgagtgccctagtatt
cagatcacatctatttcacctaactgtcatcaagggattgaagccaatgaagatgaattg
cacacaaatggaacagaaaatgagtatatggaaaggccttcacgggaccatctctatctt
cctcttgagccatcatatagggaatcatcccttagtccaagccctgccagcagcatttcg
tccagaagttggttttcagatgcctcctcctgtgaatccatttcccatgtttatgatgat
gtagactcagagctaaatgaagcagccgctcgatttacccttggctcccctttagcatct
cctggtggttctccaagaggtcccagtgatgaatcttggcagcagccatatggatttggg
catgctttgtcacctaggcagtctccctgtcattctcctagaactagtattacagatgaa
aattggctaagccctagaccaacatcaaggccctcatcaagacctacatccccctgtggg
aaacgacgacactccagtgctgagatttgctatgctggttctctctctcctcaccattct
ccaactccatcacctggccattctcccagaggaagcataacagaagacacgtggctaaac
acttccatccataacgtacaaggccttaattctggcctttcgccatttcagtgttgtaca
gagactgatattcctctaaaaacaagaaagacctcagaggatcagaccgccactttatcc
ggaaaaatagatatctgtcctgaagaacagggtaacttatcgacatcccttgaaactgca
gtagatgactgctctggatctcagcacaccttgaaaaaagatttgcctggagaccaattt
ctttctgttccttcgcactttacttggaacaaaccaaagcctggtcatactcctatattt
cgcacatcttcattgccacctcttgactggcctttaccgagtcattatgggcagtgtgaa
ctgaaaatagaagtccaacctaaaactcatcacagagctcactatgaaacagaaggaagc
agaggcgcagtaaaagcatctactggaggacaccctgtagtgaagctcctgggctatagc
gaaaagccagtaaaccttcaaatgttcatcggaacagcagatgatcgctacttaagacct
catgcgttctaccaggtgcaccgaatcactggaaaaacagttgcaacagctagtcaagag
ataataattgccagcacaaaagttttggaaataccacttcttcctgaaaataatatgtca
gccagtatcgattgtgctggtattttgaaacttcgcaattcagatatagagctccgtaaa
ggagagacagatattggaagaaagaataccagagtgcgacttgtgtttcgtgttcacatc
ccacaacctagtggaaaagtcttatctctgcagactgcttccatacctgttgaatgctct
cagcgatctgctcaagaacttcctcagattgagaagtacagcatcaatagttgctcagta
aatggaggccatgaaatggtggtgacaggatccaattttcttccagaatccaaaattata
ttttttgaaaaaggacaagatggacgacctcagtgggaggtagaagggaaaataattagg
gaaaagtgtcaaggggcaaacatcatacttgaagttcctccataccataacaaaaccatt
acagctgcagttcaggtgcagttttatctctgcaatggcaagaggaaaaaaagccagtct
caacgttttacctacacaccagttataatgaagcaagagcacagagatgaggtggatttg
tctgctgttccatctttggccctgcctcacacaagcaatgtccagggcctgcattctatc
cgaactcaattgccttcaccagagcaagggcatccacatgacaatttactgtctacatcg
cccaggagcctcgtgtgtccagttcaaccaccgtacacagccatggtgacctcagcagta
ccccacctgccacatatgcaaggtagaaaccttagtcccagcgaagagtgtcatgttttg
cctcctgctgtggttcagtcttttcaggtaacatcagcacctcctgtgaggccttcttac
cagcctatgcagtctaacgatgtatacaacggacagtctggtcttcctgtgaactctgcc
tccagccaaggatttgatactatttcatttcagcaagacacagctgtacctcatttgata
aatcttagctgccaagctctaccaccaatgcagtttcattcttcaaatccaggttctgtg
tcaacaccaagtgcagcagggcacccgctagcacaccccgctcattcaggacagtcgtct
gctcacctaccgtcgatgggataccactgcccaagcgctgggcagggctccatcccttct
gcaatgggtcaatcccttgggcagtcttctccgcagctgcagcaagtcccataccattct
acaaatccagcatccgcttcatccccatccccaacagcttcccaccctttggtccattca
ccgctgtctgggccttcttcaccccagctacaacctatgccttatcaatctcctagctca
ggacctgcctcatctcccccaccaaccactgtaagtcactcgggacagcactcccctcaa
gcacgtagtccagcattgggaggtcttaatgcagcgtcatccctagtacaccatcccgta
tgcgattcatctccattttcaccagatggggcagctattaacattaaaccagaacctgaa
gatcgagaattgaattttcaaacaataggactacaagacatcacactagatgacgtgaat
gagatcataggaagagatatgtcacagatctcggtgtcacatggaacaacagtggccagc
cagtctgcacgtacgtgtcctggatctctggagacaagaatatctgatggaatccagtaa

KEGG   Nipponia nippon (crested ibis): 104021875
Entry
104021875         CDS       T05756                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104021875 (NFATC1)
   04310 Wnt signaling pathway
    104021875 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104021875 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104021875 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104021875 (NFATC1)
Transcription factors [BR:nni03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    104021875 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 104021875
NCBI-ProteinID: XP_009473770
LinkDB
Position
Unknown
AA seq 806 aa
MGLHHNNNQFFHDEVEEAIPNAKRSPSTATLNLPNIEAYRDPSCLSPASSLSSRSCNSEA
SSYESNYSYPYTSPQTSPWQSPCVSPKTTDTEEGYQRSMVACTLLSSPRHSPSTSPRTSI
TEENWLGARNSRPPSPCNKRKYSLNGRQTSYSPHHSPTPSPQNSPRVSVTDETWLGNTNQ
YTSSAIVAAINALTTDSTIDMNDGIPIKSRKTAIDHTPSMTLKTEPAGEDHGTISPTADL
SPEDFSSFQHIRKGNFCEQYLSVPQHPYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPY
ELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLESEPLTLQLFIGTADDRLL
RPHAFYQVHRITGKTVSTTSHETILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIEL
RKGETDIGRKNTRVRLVFRVHIPQANGRTLSLQVASNPIECSQRSAQELPLVEKQSIDSF
PVIGGKKMILTGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDKEMCKPNSLVVEIPPFRNQ
RITSPVQVNFYVCNGKRKRSQYQLFTYLPANVPIIKTEPTDDYEPAQTCGPMNQGLSPLS
KPYYSQQIMMPPDPGSCLVAGFASCQQRNAVMSPSPNASPKLHDLSSSPYKCIPNPGHSH
LGLQQPSGGVPTIQEVPRSIVVHPSSPEQSSHIMLQPQVSQHLSSSCPLGYQQTLYPNSP
SSPVPSVTQEPTYLQSCSPTHSSIMGQQQQQLPKVHRNESPTTQPLSLPELHEESNHNLA
PIPVTIKREPEELDQMYLDDGKSSTA
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgggacttcatcataacaacaaccagtttttccacgatgaggttgaggaggccatccca
aatgccaagcggtcgccttccactgccactctgaacttaccgaacatcgaggcgtacaga
gacccatcctgcctgagtccagcgagtagcttgtcttccagaagctgcaactccgaagcg
tcttcctacgagtccaactactcgtatccgtacacttcaccccagacctctccgtggcag
tccccatgcgtctccccgaagaccaccgacacagaggagggctaccagcgcagcatggtg
gcctgcactttgctcagttccccgaggcactctccgtcaacgtctcccaggacaagcatc
acggaggagaactggctgggggctcgcaactccaggcctccgtctccctgcaacaagagg
aagtacagcctcaacggccggcagacctcctactccccgcaccactcccccacgccttct
ccgcaaaactcgccgcgggtgagcgtcacggatgagacgtggctggggaacaccaaccag
tacaccagctccgccatcgtcgccgccatcaacgccctcaccaccgacagcaccattgat
atgaacgacgggattcccatcaagtcgaggaagactgccatcgaccacaccccgtccatg
actctcaaaactgaaccggctggcgaggaccacgggaccatatcgccaactgccgatttg
tcaccagaagacttctccagctttcagcatatcaggaaaggaaacttctgcgagcagtac
ctgtccgtgccacagcatccctaccagtgggccaaaccaaagtctctgtctccgacatcc
tacatgagcccatccctgcctgcccttgactggcagctgccatctcactcaggaccttat
gaactgcgtattgaagtgcagccgaaatcccaccaccgagctcattacgagacggaaggc
agtcgaggggctgtgaaggcgtctgcggggggccaccctatcgtgcagctacatggttac
ttagaaagcgagccgctcacgctacagctgttcattgggactgcagacgaccgcctgctg
cgaccccatgctttctaccaggttcatcgaatcactgggaagaccgtttccaccaccagc
cacgaaacaatactttccaacaccaaagtcctggaaattccacttctgccagagaacaac
atgagagcaatcatcgactgtgctgggatattaaagctccgaaactctgacattgagctg
cgcaagggagagacggacatcggtcggaagaacacgcgcgtgcggctggtcttcagggtt
catatcccgcaggccaacggcaggaccctctccttgcaagtagcctccaaccccatcgag
tgctctcagagatctgcccaagaactgcctctggtggagaaacaaagtattgacagcttt
cctgttattggagggaaaaaaatgatactgactggccataactttctgcaagactccaaa
gtcatctttgtggagaaagcaccagatggtcaccatgtgtgggaaatggaagccaaaacc
gacaaagaaatgtgcaagccaaattcgttggtggttgagataccacctttccgcaatcag
agaattaccagccctgttcaggtcaacttctatgtctgcaatggaaagcgaaagagaagc
cagtaccagcttttcacctatcttcctgctaatgttccaattataaaaacagaacccaca
gatgactatgagcctgctcaaacctgtggaccaatgaaccaaggcttaagccctctctct
aaaccgtactacagccagcagatcatgatgccccctgatcctggttcatgcctcgtggct
ggctttgcctcctgtcagcagagaaacgccgtgatgtcaccctctcccaacgcaagcccc
aagctgcacgacctttcgtcctctccttacaagtgcatccccaacccgggccacagtcac
ctcggacttcagcagccctctggcggtgtccccaccatacaggaagtgccaaggtctata
gttgtgcacccaagctcccccgagcaatcatctcacatcatgctgcagccgcaggtgagt
caacatctgagcagtagctgtccccttggttatcaacaaacactctatcccaacagtccc
tcttctccagttccatctgttacccaagagccaacctatttgcagtcctgcagtccaact
cactcatccataatgggtcaacagcagcagcaactgccgaaggttcacagaaatgagtct
ccaacaacccaaccactgtcattgccagagttgcatgaggaaagtaatcataatttggcc
cctattcctgtaacgatcaagcgagaacctgaggaattggaccagatgtacctggatgat
ggtaagtcttccacagcatag

DBGET integrated database retrieval system