KEGG   Nipponia nippon (crested ibis): 104013238
Entry
104013238         CDS       T05756                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04141  Protein processing in endoplasmic reticulum
nni04210  Apoptosis
nni04217  Necroptosis
nni04310  Wnt signaling pathway
nni04510  Focal adhesion
nni04530  Tight junction
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104013238 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104013238 (MAPK8)
   04012 ErbB signaling pathway
    104013238 (MAPK8)
   04310 Wnt signaling pathway
    104013238 (MAPK8)
   04068 FoxO signaling pathway
    104013238 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104013238 (MAPK8)
   04137 Mitophagy - animal
    104013238 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    104013238 (MAPK8)
   04217 Necroptosis
    104013238 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104013238 (MAPK8)
   04530 Tight junction
    104013238 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104013238 (MAPK8)
   04621 NOD-like receptor signaling pathway
    104013238 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    104013238 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    104013238 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104013238 (MAPK8)
   04920 Adipocytokine signaling pathway
    104013238 (MAPK8)
   04912 GnRH signaling pathway
    104013238 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    104013238 (MAPK8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104013238 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104013238 (MAPK8)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104013238 (MAPK8)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104013238 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH DUF530 FTA2
Other DBs
NCBI-GeneID: 104013238
NCBI-ProteinID: XP_009463998
UniProt: A0A091UK40
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPAPLGAAMINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLETSA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttctacagtgttgaaattggagactctactttc
actgtattgaaacggtatcaaaacttaaaaccaataggatcaggagcacaagggatagta
tgtgcagcttatgatgccatccttgaacgaaatgttgcaataaagaagttaagccgacca
tttcagaaccaaacccatgctaaaagagcctacagagagcttgttcttatgaagtgtgtt
aatcacaaaaatataatcggcctactgaatgtgttcacaccacaaaaatccttggaagaa
tttcaagacgtctacatagtgatggagctcatggatgcaaatctctgccaagtgattcag
atggagctagaccatgaacgaatgtcctatcttctttatcaaatgctgtgtggtatcaaa
catcttcattcagctggaattatacatagggatttaaagcccagtaatatagtagtaaag
tcagactgcactttgaagattcttgactttggactggccagaactgcaggaactagtttt
atgatgacgccttatgtagtgactcgttactacagagcaccagaggtcatcctagggatg
ggatacaaagaaaacgtggatttatggtctgtggggtgcattatgggcgaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcaatggaataaagttatagagcag
ctaggaacaccatgccctgaatttatgaagaaattacagcctacagtccgaacttacgtg
gagaacagacctaaatatgctggatatagttttgaaaaactctttccagatgtccttttc
ccagctgactctgaacacaataagcttaaagcaagtcaagcaagggatttgttatcaaaa
atgctggttatagatgcttctaaaagaatctctgtggatgaagccctgcagcacccatac
atcaatgtttggtatgatccatcagaagcagaagctccaccaccaaagataccagataag
caattagatgagagggagcacacgatagaagaatggaaagagttgatatacaaggaagtg
atggacctggaggagagaaccaagaatggggttatacgtggacaaccagcccctttaggt
gcagcaatgatcaatggctctcaacatccatcttcatcgtcatctgtcaatgatgtgtct
tcaatgtcaacagatccaacattggcctctgatacagacagcagtctagaaacctcagct
ggacctctgggttgctgtagatga

KEGG   Nipponia nippon (crested ibis): 104018444
Entry
104018444         CDS       T05756                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04141  Protein processing in endoplasmic reticulum
nni04210  Apoptosis
nni04217  Necroptosis
nni04310  Wnt signaling pathway
nni04510  Focal adhesion
nni04530  Tight junction
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104018444 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104018444 (MAPK9)
   04012 ErbB signaling pathway
    104018444 (MAPK9)
   04310 Wnt signaling pathway
    104018444 (MAPK9)
   04068 FoxO signaling pathway
    104018444 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104018444 (MAPK9)
   04137 Mitophagy - animal
    104018444 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    104018444 (MAPK9)
   04217 Necroptosis
    104018444 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104018444 (MAPK9)
   04530 Tight junction
    104018444 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104018444 (MAPK9)
   04621 NOD-like receptor signaling pathway
    104018444 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    104018444 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    104018444 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104018444 (MAPK9)
   04920 Adipocytokine signaling pathway
    104018444 (MAPK9)
   04912 GnRH signaling pathway
    104018444 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    104018444 (MAPK9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104018444 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104018444 (MAPK9)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104018444 (MAPK9)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104018444 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 104018444
NCBI-ProteinID: XP_009469854
UniProt: A0A091VNZ7
LinkDB
Position
Unknown
AA seq 424 aa
MSDSKCDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgcgatggtcaattttacagtgttcaagttgcagattcaacattc
actgtactaaaacgttaccagcaattgaagcccataggatcaggggcacagggcattgtt
tgtgctgcatttgatacagtccttggaataaatgttgctgtaaagaagctgagtcgtcct
tttcagaatcaaacccacgcaaaaagagcttacagagagcttgttcttttaaaatgtgtc
aatcacaaaaatataattagtttattaaatgtatttacaccacagaagtcactagaagaa
tttcaggatgtatatttggttatggagctgatggatgcaaatttgtgccaggttattcat
atggaattggatcatgaaagaatgtcttatcttctttaccaaatgctatgtggaatcaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacgctcaaaatccttgattttggactggcaagaacagcatgtactaacttt
atgatgactccatatgtagtaacacggtattacagagcaccagaggttatccttggaatg
ggatataaagagaatgttgatatctggtcagttgggtgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagttattgaacaa
ttaggaacaccgtcagcagacttcatgaagaaactacagcctacagtgagaaactatgta
gaaaataggccaaaatatcctggtattaaatttgaagaactcttcccagactggatattt
ccatcagaatctgatcgtgacaagttaaaaaccagccaagctagagatttattatcaaaa
atgcttgtagtagatcccgacaagagaatttctgtagatgaagccttacgtcatccttat
attactgtctggtatgatccagctgaagcagaagctcctccacctcaaatctatgatgca
caattggaagaaagagaacatgcaattgaagaatggaaagaattaatatacaaagaagta
atggattgggaagaaaggagcaagaatggtgtggtaaaagatcagccctcagatgcagca
gtgaatagcaacaccagtccttcccagtcatcatctatcaatgacatttcatccatgtca
acagagcaaacattggcctcagatacagacagcagcctcgatgccttgacaggacccctt
gaaggatgtcgatga

KEGG   Nipponia nippon (crested ibis): 104019815
Entry
104019815         CDS       T05756                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04141  Protein processing in endoplasmic reticulum
nni04210  Apoptosis
nni04217  Necroptosis
nni04310  Wnt signaling pathway
nni04510  Focal adhesion
nni04530  Tight junction
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04622  RIG-I-like receptor signaling pathway
nni04625  C-type lectin receptor signaling pathway
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04920  Adipocytokine signaling pathway
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104019815 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104019815 (MAPK10)
   04012 ErbB signaling pathway
    104019815 (MAPK10)
   04310 Wnt signaling pathway
    104019815 (MAPK10)
   04068 FoxO signaling pathway
    104019815 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104019815 (MAPK10)
   04137 Mitophagy - animal
    104019815 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    104019815 (MAPK10)
   04217 Necroptosis
    104019815 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104019815 (MAPK10)
   04530 Tight junction
    104019815 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104019815 (MAPK10)
   04621 NOD-like receptor signaling pathway
    104019815 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    104019815 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    104019815 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104019815 (MAPK10)
   04920 Adipocytokine signaling pathway
    104019815 (MAPK10)
   04912 GnRH signaling pathway
    104019815 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    104019815 (MAPK10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104019815 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104019815 (MAPK10)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104019815 (MAPK10)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104019815 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 104019815
NCBI-ProteinID: XP_009471420
LinkDB
Position
Unknown
AA seq 464 aa
MSRHFLYYCGEPTLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagccgccatttcttgtattattgtggtgaacctactctggatgtgaagattgccttt
tgtcagggatttgggaaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtaggtgactcaaccttcacagtt
ctcaaacgctaccagaacttgaaacctattggctctggggctcagggaatagtttgtgct
gcatatgatgccgtccttgacagaaacgtggccattaagaagctcagcagaccatttcag
aaccaaactcatgccaagcgagcttacagggagctggtcctcatgaagtgtgtgaatcat
aaaaatattatcagtttattaaatgtcttcacaccacagaaatctctggaggagttccag
gatgtttacctggtaatggagttaatggatgccaatctatgccaggtcattcagatggag
ctagaccatgagcgaatgtcttatctactgtaccaaatgctctgtggtatcaagcatctt
cactctgcaggaattattcacagggatttaaaaccaagtaatattgtggtaaaatctgac
tgcacgttgaagattttggattttggactggccaggactgcgggcactagcttcatgatg
actccatatgtggtgacacgttactacagagcaccagaggtcatcttgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgatcagtggaataaagttattgagcagctggga
acaccctgtccagaattcatgaagaagctgcagccgacagtacggaactacgttgagaac
agacccaagtacgctggcctcactttccccaaactatttccagactctctcttcccagct
gactcagaacacaacaaactcaaagccagccaagccagggaccttttatcaaagatgcta
gtcattgatccggccaagcgaatatcagtagatgaagccttacagcatccatacattaat
gtctggtatgacccagcagaagtggaggcgcctcctcctcagatatatgataaacagctg
gatgaaagggaacatacaattgaggaatggaaagaactcatctacaaagaagtaatgaat
tctgaagaaaagactaaaaatggcgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgaaagcctccctccatcctcatctgtcaatgacatctcatccatgtcc
acggatcaaacactggcgtctgacacggacagcagcctggaagcttctgcgggacccctc
ggttgttgcaggtga

DBGET integrated database retrieval system