KEGG   Nipponia nippon (crested ibis): 104013410Help
Entry
104013410         CDS       T05756                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00020  Citrate cycle (TCA cycle)
nni00190  Oxidative phosphorylation
nni01100  Metabolic pathways
nni01200  Carbon metabolism
Module
nni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nni_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104013410 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104013410 (SDHA)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104013410 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4
Motif
Other DBs
NCBI-GeneID: 104013410
NCBI-ProteinID: XP_009464180
LinkDB All DBs
Position
Unknown
AA seq 551 aa AA seqDB search
MEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAF
GGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMESGECRG
VIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIRE
GRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAE
MCKPGEPVPPIKPNAGEESVANLDKLRFADGTIRTSELRLNMQKAMQSHAAVFRTGSVLQ
EGCEKLSQIYSDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHA
REDYKLRIDEFDYSKPLQGQQRKPFEEHWRKHTLSYVDVPSGKVTLKYRPVIDRTLNEDD
CSSVPPAIRSY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgataactggaggtggcacttctatgacacagtgaaagggtctgattggctg
ggtgaccaggatgccatacactacatgaccgagcaagccccagctgcggtgatagagctg
gaaaattatgggatgccgttcagcagaactgaagaaggaaaaatctatcagcgtgcattt
ggtggacagagtcttcagtttggaaaaggaggacaggctcacagatgctgttgcgttgca
gacaggacaggacactcactgttacatactctgtatggcaggtctctaagatatgataca
agctactttgttgaatattttgccttggacctacttatggaaagtggagaatgtcgtggt
gttattgccctttgcatagaagatggcactatacatcgttttagagcaaagaacaccgtc
attgccactggtgggtatggccgcacttacttcagttgtacatctgctcatactagtacg
ggtgatggcactgctatggtcacacgagctggtcttccttgccaggacttagaatttgta
cagtttcaccctacaggtatctatggggctggctgccttataacggaaggatgtcgtgga
gagggaggtattctaattaacagtcaaggtgaaagatttatggagagatatgcacctgtt
gctaaggatctggcttccagggatgtcgtgtctcgttctatgaccatagaaatccgtgaa
ggaaggggttgtggtcctgaaaaagaccatgtgtacttgcagttgcaccacttaccacca
cagcagctagcaactcgtctcccaggaatttcggaaacagctatgatatttgctggagtt
gatgttactaaagagcctattcctgttctgcctactgtgcattataatatgggaggtatt
cctactaactacaaaggacaggtgatcacacatgtgaatggcgaggataaagtggtacct
ggtttatatgcttgtggggaagcagcctctgcatctgtccatggcgcaaatcgacttgga
gcaaactcactcctggatttggtggtctttggtcgtgcttgtgcccttactattgcagag
atgtgcaagcctggtgagccagttccccccattaaaccaaatgctggtgaagagtcagtt
gctaatcttgacaaattaaggtttgccgatggaaccataagaacttcggaactgcgactt
aacatgcagaaggcaatgcaaagccatgctgctgtatttcgtactggttctgtactccaa
gaaggctgtgaaaaacttagccaaatttatagtgatctggctcatctaaagacatttgac
agaggtattgtctggaacactgacttggtggagacccttgaactgcaaaacctgatgctt
tgtgctctacagaccatttatggtgctgaggctcgcaaagagtcccggggtgctcatgcc
agagaggactataagttacggatagatgagtttgactattcgaagccactccaaggccaa
cagcggaagccatttgaagagcactggagaaagcacaccctttcctatgtggatgtccca
tctgggaaggttaccttgaaatacagacctgtgatcgacagaactttgaatgaagacgac
tgctcaagtgtcccgcctgctattcgctcatactag

DBGET integrated database retrieval system