KEGG   Nipponia nippon (crested ibis): 104013490Help
Entry
104013490         CDS       T05756                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00010  Glycolysis / Gluconeogenesis
nni00051  Fructose and mannose metabolism
nni00052  Galactose metabolism
nni00500  Starch and sucrose metabolism
nni00520  Amino sugar and nucleotide sugar metabolism
nni00524  Neomycin, kanamycin and gentamicin biosynthesis
nni01100  Metabolic pathways
nni01200  Carbon metabolism
nni04910  Insulin signaling pathway
Module
nni_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nni_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104013490 (HK1)
   00051 Fructose and mannose metabolism
    104013490 (HK1)
   00052 Galactose metabolism
    104013490 (HK1)
   00500 Starch and sucrose metabolism
    104013490 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    104013490 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104013490 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104013490 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104013490 (HK1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104013490 (HK1)
Membrane trafficking [BR:nni04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104013490 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 104013490
NCBI-ProteinID: XP_009464277
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFSPTAA
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGL
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctgaaggaggatcaggtcaaa
aagattgataaatacctttatgccatgcggctctctgacgaaacgctgatagacattatg
gctcgcttcaggagagagatgaagaacggcctctccagagattttagcccaacggctgca
gtgaagatgcttcctacatttgtgaggtccattcctgatggttcagagaaaggagatttc
attgcactggatcttggcggttcttatttccgaattctgcgggtgaaggtatcacatgaa
aaaaagcagacagtacaaatggaaagcgaaatttataatacgcctgaagatatcatgcac
ggcagcggaacacggctttttgatcatgttgctgaatgcctgggagactttatggagaaa
cagcaaatcaaagacaagaaattaccagtcgggtttacgttttctttcccgtgtcgacaa
tccaagctagatgagggtattctgataacctggacaaagcgcttcaaagcaagcggagtg
gagggagcagatgttgtgaggctgcttaacaaggccatcaagaaacgtggggactatgat
gcagatatcatggctgttgtgaatgacaccgtcgggactatgatgacctgtggttttgat
gaccagcgttgcgaagttggcttgatcattggcactggcaccaacgcctgttacatggag
gagatgcggcacattgacctggtggaaggggacgagggaaggatgtgcattaacacagag
tggggggcctttggagatgatggctcactagaagacatcaggactgagtttgatcgagag
atagaccgtggatcccttaatcctgggaagcagctgtttgagaagatggtcagcgggctg
tacatgggggagcttgtaaggctcatcctggtgaagatggccaaggaggggctgctcttt
gaggggagaatcacccctgagcttctcaccaaagggaagtttgagacgaagcatgtttct
gccatagaaaagagcaaagaaggtttgaacaaagccaaagaaattttaacccgcctgggg
gtggagccatcccacgaggactgcatcgccgtccagcatgtctgcaccatcgtgtccttc
cgctcggccaacctggtagcctccacgctgggtgccatcctcaaccagctgcgggataac
aaaggggtcggccgcctccggaccaccgtgggggtcgatggctccctctacaagatgcat
ccacagtatgcccggcgcttgcacaaaaccacccggcgcttggtgcctgactcggaagtg
cggttcctgctgtcagagagcggcagtgggaagggagccgcgatggtgacggcggtggca
taccggctgtcggaacagcaccggctcattgacgagacgctggccgagttcaagctcacc
catgagcagctgctgcaggtgaagaagaggatgagggcggagatggaagcggggttgaag
aagaagactcatgagactgccaaagtgaaaatgctgcccacctttgtccgcagcacgcca
gatgggacagagaatggagactttctggcacttgaccttggagggacaaactttagagtt
ttgctggtgaaaatccgcagtggtaaaaggagaacagttgagatgcacaacaagatctat
gccattcctatagaggtgatgcagggaacgggagaagagctgtttgatcacattgttacc
tgcatttctgacttcctggattatatggggataaaaggcgcacgtcttcctcttggtttt
acgttttccttcccttgcaagcagaccagtctggatgctggtatccttctcaattggaca
aaaggcttcaaagctacagactgcgagggagaagatgtggtatatttgcttagagaagga
attaaaaggagagaggagtttgacttggatgtggtggccgtggtgaacgatacagtgggc
acaatgatgacttgtgcctatgaagacccaaactgtgaaatcggactcattgtgggaact
ggcagcaatgcctgttacatggaagagatgagaaacatagagatggtggatggtgagcaa
ggacggatgtgtgtgaacacggagtggggagcgtttggggataatggatgcctggacgac
atcaggacaatatatgacaaagcggttgatgactattcactaaatgctggaaagcaaagg
tatgagaaaatgatcagtgggatgtacctgggggaaatagtccgcaatattttgattgac
ttcaccaagcgggggttcctgttcagaggccagatttcagagacactgaagaccagacat
atctttgaaaccaagttcctttctcagattgagagtgacaggttagccttgctgcaggtg
cgagccatcctccagcagctggggctcaacagcacctgcgacgacagtatcattgtcaag
accgtgtgcggagcggtgtcgaggcgagcagctcagttgtgcggtgctggaatggctgcg
gttgtagataaaatcagggagaacagaggattagagcacctggagataacggttggtgtg
gatgggactctgtacaaactacacccacacttttcgaggatcatgcaccaaacagtcaaa
gacctggcacccaactgcgacgtgaccttcctgctgtcagaggacggcagcgggaaaggg
gcagcactcatcacagcggtgggatgcaggcttcgcgatgccgagcagaactga

DBGET integrated database retrieval system