KEGG   Nipponia nippon (crested ibis): 104013536
Entry
104013536         CDS       T05756                                 

Gene name
SIRT1
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00760  Nicotinate and nicotinamide metabolism
nni01100  Metabolic pathways
nni04068  FoxO signaling pathway
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    104013536 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104013536 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104013536 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nni03036]
    104013536 (SIRT1)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104013536 (SIRT1)
Enzymes [BR:nni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     104013536 (SIRT1)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     104013536 (SIRT1)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    104013536 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 104013536
NCBI-ProteinID: XP_009464335
LinkDB
Position
Unknown
AA seq 603 aa
MWLKCNPSLLCCLADNFLFSDEIIANGFHSCDSDEDDRASHASSSDWTPRPRIGPYTFVQ
QHLMLGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIDDAVKL
LQECKKIMVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPF
FKFAKEIYPGQFQPSLCHKFIALMDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATA
SCLICKYKVDCEVVRGDIFNQLAIMKPDIVFFGENLPEQFHRAMKYDKNEVDLLIVIGSS
LKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCQRLGSEYTKLCY
NSVKLSEITEKPPRTHKELEIHSAELPPTPLNISEDSSSPERMTPPDTSVVSSEHPAECK
VENCDPASETKGTCTEEKLQETQTSENPENPTSELMNSETMKENGSNNGENKEKNEILKK
CWVNRSAKEQISKRLDGTQYLFLPPNRYIFHGAEVYSDSEDDIISSSSCGSSSESGSCRS
QSLDVEDESEIEEFYNGIEDEDAPEREEEPGFGEDGVEQDESAADESAYANEAAGTDHPS
NKL
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgtggctcaagtgtaacccgtcattgttgtgctgtcttgcagataacttcctttttagc
gatgaaatcatagccaatggttttcactcctgtgatagtgatgaagatgacagagcctca
catgcaagttctagtgattggaccccaagaccacgtataggtccctacacttttgttcag
cagcatctcatgttaggtacagacccacggacaattctgaaagacctgctaccagaaaca
atccctccacctgaactggatgatatgacactgtggcaaattgttataaacattctttca
gaaccacccaaaagaaaaaaacgaaaagacattaacactattgatgatgctgtgaaactt
ttacaagaatgcaaaaaaataatggtcttgactggagctggggtgtctgtgtcttgtgga
atacctgactttagatcaagagatggcatctatgcacgccttgctgtagacttcccagac
cttccagatcctcaagcaatgtttgatatagaatacttcagaaaggatcccaggccattt
tttaagtttgcaaaggaaatctatccaggacaattccagccatctctctgtcacaagttc
atagctttgatggataaagaaggaaaactacttcgcaactatactcagaacatagacaca
ttggaacaggttgcaggaatccaaaggataatacagtgtcacggttcctttgcaacagct
tcctgcctgatctgtaaatacaaagtcgattgtgaagttgttcgaggagatattttcaat
cagctcgctatcatgaagccagacatagtgttctttggagagaacttacctgagcagttc
catcgtgccatgaagtacgacaaaaatgaagttgatctccttattgttattgggtcttca
ctgaaagtaagaccagtagcattgattccaagttccatcccccatgaagtgcctcagatc
ttaattaatagggaacctttgcctcatctacactttgacgtggagcttcttggagactgt
gatgttattattaatgaattatgtcaaaggctaggtagcgaatacacaaaactttgctac
aactcagtaaaactttcagaaataacagaaaagcctccccgaacgcacaaggagcttgaa
atacactcagccgagctaccgcctacccctttaaacatttcggaagactctagttcacca
gaaaggatgactccaccagatacttcggtggtgtcttcagaacacccagctgaatgtaag
gtagaaaactgtgatcctgcctcagaaactaaagggacctgcacagaggaaaagcttcag
gagacacagacatcagaaaaccctgaaaatcctactagtgaattaatgaactctgaaaca
atgaaggaaaatggatctaacaatggagaaaataaagaaaaaaatgaaatattgaagaag
tgctgggtaaacagatctgcgaaagaacagattagcaaaaggctggatggtactcagtat
ctatttttgccaccaaatcgctatattttccacggtgctgaggtttactcagattctgaa
gatgatatcatatcttctagctcttgcgggagtagtagtgaaagtggttcatgtcgtagt
cagagcttagatgtggaggatgagagtgagatcgaagagttttacaatggcatagaggat
gaggatgctcctgaaagggaagaggaacctggattcggggaagatggagttgaacaagat
gaatcggcagccgatgaatcagcttatgcaaatgaagctgcagggactgatcatccaagc
aacaagttgtaa

DBGET integrated database retrieval system