KEGG   Nipponia nippon (crested ibis): 104013846
Entry
104013846         CDS       T05756                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04080  Neuroactive ligand-receptor interaction
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104013846 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104013846 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nni04030]
    104013846 (LPAR2)
G protein-coupled receptors [BR:nni04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    104013846 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 104013846
NCBI-ProteinID: XP_009464665
LinkDB
Position
Unknown
AA seq 344 aa
MKHCFYNETVGFFYNNSRKELTTYWRTKDVLVVALGLTVSVIVLLTNLLVITAIIINRRF
HYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHQTVFTMQLHSKMSNQRVMILIFCIWVTALLLGLIPSYGWHCLCALEKCSSMAP
LYSRSYLTFWAISNLVIFLIMVVVYTHIFIYVKRKMTRMSKHTSFHPRYKETMISLVKTV
TIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLAEINSLINAIVYSYRDNEMR
STFRRILCFVCYRNSKYTPTVVKLNTTDRRTLSQNGHFTVDSSI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaagcactgtttttacaatgagactgtggggttcttctacaacaacagccgcaaagag
ctgaccacatactggaggacaaaggatgtcctggtcgttgccctgggcctgacggtgagt
gtcatcgtgctcctgaccaacctgctggtcatcaccgctatcatcatcaaccggcgtttc
cactaccccatctactacctgctggggaacctggcagctgccgacctctttgctggcatc
gcgtacatgttcctcatgttccacacggggcccaggacagcagagctctccctgaagacc
tggttcatccgccagagcctgctggacaccagcttgacagcctccgtggtgaacctgctg
gcgatcgctgtagaaaggcaccagactgtgttcaccatgcagttacacagcaaaatgtcc
aaccagcgtgtgatgatcctgatcttctgtatttgggtcacggccctgctcctggggctc
atcccgtcctacggctggcactgcctctgtgccctggagaagtgctccagcatggcaccg
ctctacagcaggagctacctgaccttctgggccatctccaaccttgtcatcttcctgatc
atggtggttgtgtacacgcacatcttcatctatgtcaaaaggaagatgacacggatgtcc
aagcatactagtttccacccccgctacaaggagaccatgatcagccttgtcaagacggtc
accattatcctaagtgcttttgtcatctgctggactccaggacaagttgtgctcctcctg
gatggcttgggctgcaagagctgcaatgttctagcggtggagaaatacgtccttttgctg
gcagagatcaattcgttgataaacgctattgtctactcttacagggacaatgagatgcgt
agcaccttccggaggatcctctgctttgtctgttataggaattccaaatacacccccacg
gtggtgaagctgaacaccacagaccgcagaacgctttctcagaacgggcactttactgtg
gattcctctatttag

DBGET integrated database retrieval system