KEGG   Nipponia nippon (crested ibis): 104013985
Entry
104013985         CDS       T05756                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04060  Cytokine-cytokine receptor interaction
nni04068  FoxO signaling pathway
nni04218  Cellular senescence
nni04620  Toll-like receptor signaling pathway
nni04621  NOD-like receptor signaling pathway
nni04623  Cytosolic DNA-sensing pathway
nni04625  C-type lectin receptor signaling pathway
nni04672  Intestinal immune network for IgA production
nni05132  Salmonella infection
nni05164  Influenza A
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104013985 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104013985 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104013985 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104013985 (IL6)
   04621 NOD-like receptor signaling pathway
    104013985 (IL6)
   04623 Cytosolic DNA-sensing pathway
    104013985 (IL6)
   04625 C-type lectin receptor signaling pathway
    104013985 (IL6)
   04672 Intestinal immune network for IgA production
    104013985 (IL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104013985 (IL6)
  09172 Infectious disease: viral
   05164 Influenza A
    104013985 (IL6)
   05168 Herpes simplex virus 1 infection
    104013985 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104013985 (IL6)
Cytokines and growth factors [BR:nni04052]
 Cytokines
  Interleukins
   104013985 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 IL11 Bac_GDH
Other DBs
NCBI-GeneID: 104013985
NCBI-ProteinID: XP_009464839
LinkDB
Position
Unknown
AA seq 174 aa
METKQELPSFHEKGATKTLGVSPQMCEKFTVCENSMEMLVQNNLNLPKVTEEDGCLLAGF
DEDKCLRKISSGLYTFQTYLEYVQETFTSEKQNIESLCYSTEHLARTLRQMVINPSEVII
PDSATQESLRAKLKSDKTWIEKITTHLILRDFTSFMEKTVRAVRYLKNTRSFSV
NT seq 525 nt   +upstreamnt  +downstreamnt
atggagacaaagcaagagctaccctccttccacgagaaaggtgcgaccaaaactcttggt
gtctctccccagatgtgcgagaagtttaccgtctgcgagaacagcatggaaatgcttgtc
cagaacaacctcaacctccccaaggtgaccgaggaagacgggtgtctgctcgccggcttc
gatgaggataaatgcttgaggaaaatctccagcgggctttacacatttcagacatacctt
gaatacgtacaagagacttttactagcgaaaagcaaaacatcgaatcgctgtgctatagc
acagagcacctggcacgtaccctaagacagatggtgataaaccccagtgaagtgatcatc
ccagactcagctacccaggaatccctccgtgcaaagctgaagtccgataagacctggata
gagaaaatcaccacccacctcatcctccgagactttacttcatttatggagaaaaccgtg
agggccgttcgttatttgaaaaacaccaggagtttcagtgtctga

DBGET integrated database retrieval system