KEGG   Nipponia nippon (crested ibis): 104014240
Entry
104014240         CDS       T05756                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04371  Apelin signaling pathway
nni04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104014240 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104014240 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104014240 (EGR1)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    104014240 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 INTAP Zf_RING MC1 zf-C2H2_8 zf-H2C2_5 zf-C2HC_2 zf-BED
Other DBs
NCBI-GeneID: 104014240
NCBI-ProteinID: XP_009465135
LinkDB
Position
Unknown
AA seq 542 aa
MRGASQNPQQMFAFVKKGKTPNRIFRRELWPSALAVGKQHGFSPSRASIAAQLRMSCGSA
PRAAGTRELSPFFPAALRGCSPSPVLGRERTGAAGSGPQYSSAVKRAQGRDTFPEISLNN
EKTLPETSYPNQTTRLPPITYTGRFSLEPAPNSSNTLWPEPLFSLVSGLVGMANAPPAST
PSSSSPSSSSQSPPLSCSVQASENSPIYSAAPTFPNSSSDVFPEPQTQSFPNPSGAPIQY
PPPAYPSAKTNFQVPMIPDYLFPQQQGELSLVPADQKPFPALETRAQQPSLTPLSTIKAF
ATQTGSQELKTLNTNYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDEL
TRHIRIHTGQKPFQCRICMRNFSMRDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHT
KIHLRQKDKKVEKAAPVSTASPIPAYSSSVTTSYPSSIATTYPSPVRTVYSSPAPSSYPS
PAHTTFPSPSVATTYPSGTATFQTQVATSFSSPGVTNNFSSQVTSALSDMTSAFSPRTIE
IC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgcgtggggcttctcaaaacccgcagcagatgtttgcatttgttaaaaaaggaaaaaca
ccgaatcgcattttcagacgagagctttggcctagcgcactggcggtcggaaagcagcac
ggcttctccccgtcaagagcaagcatcgcagcacagctgcgcatgagctgcggctccgca
ccgcgggctgcggggacgcgggagctgtcgccgtttttcccggcggcgctgcgcggctgc
agcccgtcaccggtgctcggccgggaacgcaccggcgccgccgggagcggccctcagtat
agcagcgccgttaagagggcgcagggccgagacacttttcccgagatctccctgaacaac
gagaaaaccctgccagaaaccagctatcccaaccaaacgacgcggctgccaccgataacc
tacaccgggcgcttctccctagagccggcccccaacagtagcaacaccctgtggccagag
cccctcttcagcctggtcagtgggctggtgggcatggctaacgcaccccccgcctccacg
ccttcctcatcctcaccgtcctcctcctcgcagagcccccctctgagctgttccgtccaa
gccagtgagaacagtcccatttattcggctgcaccaactttccccaattccagctctgac
gttttccctgaaccgcagacccagtcctttcccaacccctccggagcacccatccagtac
ccacctccagcttatccgtctgctaagaccaactttcaggtgccaatgatcccggattac
ctgttccctcagcaacagggtgagctcagcctcgtcccggctgaccagaagcccttccca
gcccttgagaccagagcccagcagccttccctcacgccgctgtccaccattaaggcgttt
gccactcagactggctcccaagagctgaagaccctcaacactaactatcagtcccagctg
atcaagcccagcaggatgaggaaataccccaaccgtcccagcaagacccctcctcatgag
cgaccctatgcctgcccggtggagtcctgtgaccggcggttttcgcggtccgacgagcta
acgcggcacatccgcatccacacgggacagaaacctttccagtgccgcatttgcatgcgg
aacttcagcatgagagaccacttgactacgcacatccgtacgcacacaggagagaagcca
tttgcctgtgacatttgtggcagaaagtttgccagaagcgatgagaggaagaggcacact
aaaatccaccttaggcagaaggacaagaaagtggaaaaggcagctccggtctcaaccgct
tcccccatccctgcctactcgtcctctgtgactacatcctacccttcctccatcgccacc
acttacccctcgccagtgcgcaccgtgtactcctcccctgccccctcctcctacccctcc
cctgcgcacaccaccttcccctctccttccgtagcgaccacttacccctccggcaccgcc
acttttcagacccaagtggccacctccttctcatctccaggggtcaccaacaatttcagc
tcgcaggtgacctcagcactttcagacatgacgtcagccttttctccaaggacaattgag
atttgctga

DBGET integrated database retrieval system