KEGG   Nipponia nippon (crested ibis): 104014503Help
Entry
104014503         CDS       T05756                                 

Gene name
ZBTB16
Definition
(RefSeq) zinc finger and BTB domain-containing protein 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nni04121]
    104014503 (ZBTB16)
Ubiquitin system [BR:nni04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     104014503 (ZBTB16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_6 zf-C2H2_jaz zf-met zf-C2H2_2 zf_UBZ Endonuclease_7 zinc_ribbon_15 MIX zf-C2H2_11 zf-MYST Zn-C2H2_12 zinc_ribbon_2 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 104014503
NCBI-ProteinID: XP_009465428
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MDLTKMGMIQLQNPCHPTGLLHKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKVEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASEDNDTEVAMGDGGAAAAEEEEERKSRYIRGLFVSKPAGEESGYAGAAGQSLP
AAARGEKPLGIYSLLPNHKTEPVLGVPPSVASALHVQPALAVSMDFSAYGGLLPQGFIQR
ELFSKLGELAAGMKTESRALGEQCSVCGAELPDNETLEQHRKLHSGMKTYGCELCGKRFL
DSLRLRMHLLAHSAGAKALVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQTQ
SALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLK
GHKRIHTGEKPYECNGCGKKFSLKHQLETHSAAASMPGEKPFECKLCHQRSRDYSAMIKH
LRTHNGASPYQCTICLEYCPSLSAMQKHMKGHKPEEIPTDWRIEKTYLYLCYV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatttgactaagatgggcatgatccagctgcagaacccctgccaccccaccgggctg
ctgcacaaagccaaccagatgcgcctggcggggacgctgtgcgacgtggtcatcatggtg
gacagccaggagttccacgcgcaccggacggtgctggcctgcaccagcaagatgttcgag
atcctcttccaccgcaacagccagcactacaccctggacttcctctcgccaaagacgttc
cagcagatcctggagtacgcgtacaccgccaccctgcaggccaaggtcgaagacttggac
gacctgctctacgccgccgagatcctggaaatcgagtacctggaggagcagtgcctgaag
atcctggagaccatccaggcctccgaggacaacgacaccgaggtcgccatgggcgacgga
ggcgccgccgccgccgaggaagaggaggagaggaagtcgaggtacatcaggggcctcttc
gtctccaagcccgccggcgaggagagcggctacgccggcgcggccggccagagcctcccc
gccgccgcccggggggaaaagcccctgggcatctactccctgctgccgaaccacaagact
gagccggtgctcggtgtgccgccctccgtggcgtccgccctgcacgtgcagccggccctg
gccgtctccatggacttcagcgcctacggggggctgctgccccagggcttcatccagcgg
gagctgttcagcaagctgggggagctggcggccggcatgaagacggagagcagagccctg
ggcgagcagtgcagcgtgtgcggggcagagctgccggacaacgagaccctcgagcagcac
aggaagctgcacagcgggatgaagacttacggatgcgagctgtgcgggaagcggttcctg
gacagcttgcggctgcgaatgcacttactggctcactcagcgggcgccaaagccctggtc
tgcgatcagtgcggcgcccagttctcgaaggaagacgccctggagacgcacaggcagacg
cacaccggtacggacatggccgttttctgcctgctgtgtggcaagcggttccagacgcag
agcgccctgcagcagcacatggaggtgcacgccggggtgcgcagctacatctgcagcgag
tgcaaccgcaccttccccagccacaccgcgctcaagaggcacctccgctcccacacaggc
gaccacccctacgagtgcgagttctgcggcagctgcttccgggacgagagcaccctcaag
ggccacaagcgcatccacaccggcgagaagccctacgagtgcaacggctgcggcaagaag
ttcagcctcaagcaccagctggagacccactccgcggcagcgtcgatgccgggcgagaag
cccttcgagtgcaagctgtgccaccagcgctcccgggactactcggccatgatcaaacac
cttcggacccacaatggcgcttccccctaccagtgcaccatttgcctggagtactgcccc
agcctctccgccatgcagaagcacatgaagggccacaagccggaggagatccccaccgac
tggcggatagagaagacctatctctacctctgctacgtctga

DBGET integrated database retrieval system