KEGG   Nipponia nippon (crested ibis): 104014763
Entry
104014763         CDS       T05756                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00230  Purine metabolism
nni01100  Metabolic pathways
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104014763 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104014763 (ADCY3)
   04020 Calcium signaling pathway
    104014763 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104014763 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104014763 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104014763 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    104014763 (ADCY3)
   04916 Melanogenesis
    104014763 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104014763 (ADCY3)
   04270 Vascular smooth muscle contraction
    104014763 (ADCY3)
Enzymes [BR:nni01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104014763 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 104014763
NCBI-ProteinID: XP_009465714
LinkDB
Position
Unknown
AA seq 1126 aa
MPRNRAFSEPECSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLVMCAVVYAADKLAPVLAAAAGLVAHVL
LFILCKYKLLPERATRRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAISCGVHTLVLGVTVAQQRQDALDEGTLLRQILSNVAIYLCAITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAVSAT
PPACNERGSYVREKTKTAVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGI
PGRVHISQSTMDCLKGEFEVEPGEGGSRCEYLKEKGIVTYLVVVPKQPLRNGINGVKLSL
TSSHGGSPPLVNTKERNGSLSLACASPEEPEEPDVRVRGALESGEEDGEAVNPSFPNPRR
RLRLRDLAERVIDASQNEQELNKLLNEALLERESVQALKGKSTFRLSMRFIDPEMETRYS
VEKEKQSGAAFSCSCVVLFFTALVEVFIDPWLVANYVTFVVGEILLLILTLCSLAAIFPR
VFPKKLVAFSTWIDRTRWARNTWAMAAIVIVTMADIVDMLSCRQDHVETGNGTAGPPWPG
GCGEQPKYYSYIALLALVATIMLVQVSHMVKLTLMVLITGAAGTVNIYAWEHIFDQYDRR
RGQQSTXGVARGGGAWVGGMAMPTTHPRLAASAGRSSLVPSKYSMTAMIFIVMLSFYYFS
RHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQ
SYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTI
GSTYMAASGVTPDANANGYSAKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFNNF
MLRIGMNKGAVLAGVIXEKKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEYGF
RFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggctttttcggagcccgagtgctcagccgagtactccgccgactac
tcggtgagcctgccctcggaccccgagcacggcgtgggtcggacccacgaggtgacggtg
cgcagctcgggaccctgcctctgcctcccccgcttcatgcgcctcaccttcgctcccgaa
tccctggagaacctctaccagacctatttccgtcgccaacgccacgagaccctcctggtg
ctggtggtcttcgctgccctctttgattgctacgtcctcgtcatgtgcgccgtggtctac
gccgctgacaagctggccccagtgttggcggcggcggccgggctggtcgcccatgtgctg
ctcttcatcctctgcaagtacaagctgctccccgagcgggcgacccgcaggttcctgccc
tacgtcctctgggtcctcatcttggcccagatcttctgctacctgggtctcaacttctcc
cgctcgcccgaggccagcgatacggtgggttggcaggctttcttcgtcttctccttcttc
atcacgctgccgttgcggttggcgcccatcgtgctcatcaccgccatctcctgcggcgtt
cacacgctggtgctcggtgtcaccgtcgcccagcagcggcaggacgccctggacgagggc
acactgctgagacagatcctgtccaacgttgccatctacctttgcgccatcacggtgggc
atcatgtcgtactacatggccgaccgcaagcaccgcaaagccttcctcgaagcgcgccag
tccctcgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcacgtggccgatgagatgctgaaggacatgaagaaggacccaagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctcttcgcagacatcgtgggcttcacccagctctcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagccgtgagtgccacc
cccccggcatgtaacgagcggggcagctacgtacgggagaagaccaagacggcggtggac
atgcgggtgggggtgcacagcgggacggtgctggggggcgtgctgggccagaagcgctgg
cagtacgacgtgtggtccaccgacgtcaccgtggccaacaagatggaggcgggcggcatc
cccgggcgggtgcacatctcgcagagcaccatggattgcctgaagggtgagttcgaggtg
gagccgggtgaaggtggctcacgctgcgagtacctgaaggagaagggcatcgtcacctac
ctcgtcgtcgtccccaagcaacccctgcgcaacggcatcaacggggtgaagctgtcgctg
acctcgtcccatggtggctccccgccgttggtcaacaccaaggaacgcaacggcagcctc
agcctggcctgcgccagccccgaggagcccgaggagcccgacgtcagggtgaggggcgcc
ctggagagcggggaggaggatggagaggcggtgaatccctccttccccaacccgcggcgg
cggctgcggctgagggacctggccgagcgggtgatcgacgcctcgcagaacgagcaggag
ctcaacaagctgctcaacgaagccttgctggaacgtgaatccgtccaggcgctgaagggg
aagagcaccttccggctctccatgcgcttcatcgaccccgagatggagacgcgctactcg
gtggagaaggagaagcagagcggggctgccttcagctgctcctgcgttgtcctcttcttc
actgccttggtggaggtcttcatcgacccctggttggtggccaactacgtgaccttcgtg
gtgggggagatcctgctgctcatcctcaccctctgctcgttggctgccatcttcccccgg
gtcttccccaaaaagctcgtggccttctccacctggatcgacaggacccgctgggcacgc
aacacctgggccatggccgccatcgtcatcgtcaccatggccgacatcgtggacatgctc
agctgccggcaggaccacgtcgagacgggtaacgggacggcggggccaccgtggccgggc
ggctgcggggagcaacccaagtactacagctacatcgccctgctggctttggtggccacc
atcatgctggtgcaggtcagccacatggtcaagctgaccctcatggtgctgatcaccgga
gccgccggcaccgtcaacatctatgcctgggagcacatcttcgaccagtacgaccgccgc
cgtggccagcaaagcacgtaaggggtggcgagggggggtggggcatgggttgggggcatg
gccatgcccaccacccacccacgcctcgctgcctctgccggcaggtcctcgctcgtcccc
tccaagtactccatgacggcgatgatcttcatcgtgatgctcagcttctactacttctct
cgccacgtggagaagctggccaggaccctcttcctttggaagatcgatgtccacgaccag
aaggagcgggtctacgagatgcggcgctggaacgaggccctcgtcaccaacatgctgccc
gagcacgtggcccggcacttcctgggctccaagaagcgggatgaggagctgtacagccag
tcctacgatgagatcggcgtcatgttcgcctccctccccaactttgccgacttctacacg
gaggagagcatcaacaacgggggcattgagtgcctgcggttcctcaacgagatcatctcc
gactttgacgcgctcctggacgaaccccaattccggtgcatcaccaaaatcaaaaccatc
ggcagcacctacatggctgcttctggagtgacccccgatgccaacgccaacggctacagc
gccaagaaggagaccctctcggataaggagcgctggcagcacttggctgacctggctgac
tttgccttagccatgaaggtgacgttgatgaacatcaactaccaatccttcaacaacttc
atgctccgcataggcatgaacaagggggccgtgctggcgggcgtcatcnaggaaaaaaag
cctcactacgacatctggggcaacacggtgaacgtggccagcaggatggagtccaccggc
gtgatggggaacatccaggtggtggaggagacccacctcatcctgaaggaatacggcttc
cgcttcgtgcgccggggagccatctacgtcaagggcaaaggggagctgctcaccttcttc
ctcaagggccgggagaaacagggctccttcgtcaacggctcctccgtcaccctgccccat
caggtggtggacagctcgtga

DBGET integrated database retrieval system