KEGG   Nipponia nippon (crested ibis): 104015461
Entry
104015461         CDS       T05756                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04140  Autophagy - animal
nni04261  Adrenergic signaling in cardiomyocytes
nni04270  Vascular smooth muscle contraction
nni04310  Wnt signaling pathway
nni04340  Hedgehog signaling pathway
nni04371  Apelin signaling pathway
nni04530  Tight junction
nni04540  Gap junction
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104015461 (PRKACB)
   04310 Wnt signaling pathway
    104015461 (PRKACB)
   04340 Hedgehog signaling pathway
    104015461 (PRKACB)
   04371 Apelin signaling pathway
    104015461 (PRKACB)
   04020 Calcium signaling pathway
    104015461 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104015461 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104015461 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104015461 (PRKACB)
   04540 Gap junction
    104015461 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104015461 (PRKACB)
   04912 GnRH signaling pathway
    104015461 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    104015461 (PRKACB)
   04916 Melanogenesis
    104015461 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104015461 (PRKACB)
   04270 Vascular smooth muscle contraction
    104015461 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104015461 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nni03019]
    104015461 (PRKACB)
   03036 Chromosome and associated proteins [BR:nni03036]
    104015461 (PRKACB)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104015461 (PRKACB)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: AGC group
  PKA family
   104015461 (PRKACB)
Messenger RNA biogenesis [BR:nni03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104015461 (PRKACB)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104015461 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 104015461
NCBI-ProteinID: XP_009466493
UniProt: A0A091WFF0
LinkDB
Position
Unknown
AA seq 398 aa
MAAQKEVPCNQCTGTATALQRLEGFANRLFHRHSKSGAHEQRAALENESQHCSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagctcagaaggaggtaccttgtaaccagtgcacagggacagccacagcgctgcag
agactggaaggttttgcgaatcgccttttccataggcattcaaagagtggtgcgcatgaa
cagagagcggctctggaaaatgagagccaacattgctctgaacttgctgtcctatgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagaggcaaaaaacccttggaacagga
tcattcgggagagttatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcaaatagaacacacactgaatgagaag
agaatattacaagcggtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgaaatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagccaattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctgaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccgttcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system