KEGG   Nipponia nippon (crested ibis): 104015558
Entry
104015558         CDS       T05756                                 

Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104015558
   04068 FoxO signaling pathway
    104015558
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104015558
Transcription factors [BR:nni03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    104015558
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-H2C2_5 zf-C2H2_8
Other DBs
NCBI-GeneID: 104015558
NCBI-ProteinID: XP_009466605
LinkDB
Position
Unknown
AA seq 166 aa
MATVAATGAGTTSKPPPPQFHGHFSVFREPLKGPGPGPAGLPGLLVTPPNSPVLEYFPAG
APPEDCKPKRGRRSWARKRTATHNCEYPGCGKTYTKSSHLKAHMRTHTGEKPYHCTWEGC
GWKFARSDELTRHYRKHTGHRPFQCHLCERAFSRSDHLALHMKRHM
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcaacagtcgctgccactggcgctggcaccaccagcaagccgccgccgccgcagttt
catggacacttcagtgttttcagggagcccctgaaggggccggggccgggcccggcgggg
ctgcccgggctgctggtcacgccgcccaactccccggtgctggagtacttcccggccggg
gcccctcccgaggactgcaagcccaagcgtggtcgccgttcgtgggcacgcaagcggacg
gccacgcacaactgtgaatacccgggctgcggcaagacctacaccaagagctcccacctc
aaggcgcacatgcggacccacacgggcgagaagccctaccactgcacctgggaaggctgt
ggctggaaatttgcccgctccgatgagctgacccgccactaccgcaagcacacggggcac
cggcccttccagtgccacctctgcgagcgggctttctcccgctccgaccaccttgccctc
cacatgaagcggcacatgtga

KEGG   Nipponia nippon (crested ibis): 104018728
Entry
104018728         CDS       T05756                                 

Gene name
KLF2
Definition
(RefSeq) Krueppel-like factor 2
  KO
K17845  krueppel-like factor 2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104018728 (KLF2)
   04068 FoxO signaling pathway
    104018728 (KLF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104018728 (KLF2)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    104018728 (KLF2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 104018728
NCBI-ProteinID: XP_009470167
UniProt: A0A091VQT3
LinkDB
Position
Unknown
AA seq 380 aa
MALSDTILPSFATFASPCREKALHERWKCDQEAKTPAGTWGGLSPRKEDEDLNNVLDFIL
SMGSDGYGQGAAGGDYPPAQGESGGFYQTNPSPGCYSALEQGSPPPYNAGIVPEMIRSEM
DSNYCPPGNVHGRFFVTPSFGGPQFVENIKPEPDMDNYGPVLGLVPQACPKIKQEGNATC
MMAYEQPRVASSPQIPGAETPPLSPDDLMVNDCHTQMMCPSSVSFQQSYHPASGFHHPQT
HLQYQNTSQFGLFEDSLPLQPSAPRGMLTPPSSPLELLDSKPKRGRRSWPRKRTATHTCT
YAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHYRKHTGHRPFQCH
LCDRAFSRSDHLALHMKRHM
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcgctgagcgacaccatcctgccctccttcgccaccttcgccagcccctgccgcgag
aaagccctccacgaaaggtggaagtgcgaccaggaggccaagacccctgccggcacctgg
ggcggcctctcccctcgcaaagaggatgaggatctcaacaacgtgctggattttatcctt
tccatgggcagcgacggctacggccagggcgcagctggtggggattatccccctgcccaa
ggggagagcggtggcttttaccagacaaacccgtccccgggatgctacagtgccctggag
cagggcagccccccaccctacaacgccggcatcgtgccggagatgatccgctccgagatg
gactccaactactgccctcccggcaatgtccatgggcggttcttcgtgacacccagcttc
gggggcccgcagttcgttgagaacattaagcccgagcccgacatggacaattatggaccg
gtcctgggtctggtgccccaggcttgcccgaagatcaagcaggagggcaacgcgacctgc
atgatggcctacgagcagccgcgggtggccagctccccccagatcccgggggcagagacg
cccccactgagccccgacgatctcatggtgaatgactgccacacgcagatgatgtgcccc
tcgtccgtgtccttccagcaaagctaccacccggcctccggcttccaccacccgcagacc
catctccagtaccagaacacctcccagtttggccttttcgaggacagcctgcccttacaa
ccctccgctcccagaggcatgctcacccctccttcctcccctctggagctgctggactcc
aaaccaaaaagaggacgccggtcttggccacggaagaggacggccactcacacgtgcacc
tatgcgggctgcgggaagacctacaccaagagttcgcacctgaaggcccacctcaggacg
cacacaggtgaaaagccctaccactgcaactgggaaggctgcggctggaagttcgctcgc
tccgacgaactcacccgtcactatcgcaagcacaccggccaccggcccttccagtgccac
ctctgcgacagggcgttctccaggtcagaccacctggcgttgcacatgaaacggcacatg
tag

DBGET integrated database retrieval system