KEGG   Nipponia nippon (crested ibis): 104015845Help
Entry
104015845         CDS       T05756                                 

Gene name
PCSK1
Definition
(RefSeq) LOW QUALITY PROTEIN: neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nni01002]
    104015845 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nni03110]
    104015845 (PCSK1)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     104015845 (PCSK1)
Peptidases [BR:nni01002]
 Serine Peptidases
  Family S8: subtilisin family
   104015845 (PCSK1)
Chaperones and folding catalysts [BR:nni03110]
 Intramolecular chaperones
  Subtilisin family
   104015845 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 104015845
NCBI-ProteinID: XP_009466910
LinkDB All DBs
Position
Unknown
AA seq 756 aa AA seqDB search
MVQKARVLCQAAPLAALGTPQSRFPPAPWRADPRRELAGSGREVPSPQPLPGLLPGRSSD
SETSIGSLKNHYLFRRKSHPRRSRRSAIHITKRLSDDERVSWAEQQYEKKRTKRATVRDS
AENLFNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTD
IYANYDPQASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSKVG
GIRMLDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGR
NGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYS
SGDYTDQRIVGCFYQIQNKHRNVLYVQITSESSXMLAGIFALALEANPNLTWRDMQHLVV
WTSEYDPLAGNPGWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKGVPEKRECIVKDK
SFEPRLLRANEEVIIEIPTKACEGQENSIASLEHVQLEATIEYSRRGDLHVTLVSPSGTT
TVLLAERERDKSPNGFKNWDFMSVHTWGENPTGTWVLRITDVSRRIQNEGRIVNWKLILH
GTATQPEHMKQPRVYTSYNAVQNDRRGVEKMTDFVEDHTTQENLSEKPKVTEDTSSSSDK
AEDKIPSEAMLHLLQSAFSRQMSQKRLPKKTASEKLNIPYEHFYQALEKLNKHSQLRDSE
ESLYSDYVDLFYNAKPYKHRDDRLLQALVDIINEGN
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaagcgagggtcctgtgccaggcagcgcctctggcagcgctggggaccccg
cagagccgcttcccacccgcgccgtggcgtgcagacccccgccgggagctggccggcagc
gggagggaggttccctctcctcagccccttcccggcctcctgcccgggcgttcttcggac
tctgaaacctcgattggatcactcaaaaatcactacctattcagacgtaaaagccatcca
aggcggtctcgaagaagtgccattcatatcactaaaagactttctgatgatgagcgggtg
tcatgggcagagcaacaatatgaaaaaaagcgaactaagcgtgccactgtgagagactca
gcagaaaatcttttcaatgatcctatgtggaatcagcagtggtatctgcaagatacaaga
ataactccatccctgcccaaactggatctccatgttattcctgtatggcaaaaagggatt
acaggcaagggtgttgtcatcacagtactagatgatggcttggagtggaatcacactgac
atctatgctaactatgatcctcaggcaagttatgatttcaatgacaacgatcacgatccc
tttcctagatatgacccaacaaatgaaaacaagcatgggacacggtgtgcaggagaaatt
gccatgcaagccaacaacagaaaatgtggagttggagtagcttacaattccaaagttgga
ggtatacgtatgctggatggaatagtcaccgatgctattgaagccagctcaattggtttc
aatccagaacatgtggatatttacagtgcaagctggggccctaatgatgatggtaaaact
gtggagggacccgggagactggcacagaaggcttttgagtatgggattaaacagggccga
aatgggaaaggctccattttcgtatgggcttctgggaacggaggccgtcagggtgacaac
tgtgactgtgatggttacactgatagtatctacactatctccattagcagtgcttctcag
caaggcctttctccctggtatgcagagaagtgctcttcaactctggccacagcatacagc
agtggggattatactgaccaaagaattgtaggttgtttttaccagattcagaacaaacat
agaaatgtattatatgtgcaaataacaagtgagagctcttaaatgcttgcaggaattttt
gctctagcgctggaagcaaacccaaatctaacatggagggatatgcagcacttggtagtg
tggacgtcagaatatgatccactggctggaaatccaggatggaaaaagaatggagcggga
ctgatggtcaacagccgatttgggtttggactactcaatgccaatgcgttggtagattta
gctgatcccaaaagatggaaaggtgtaccagaaaagagagaatgtatcgttaaagacaaa
agctttgaaccaagattattaagagcaaatgaggaagtcatcattgaaattcccacaaaa
gcctgcgagggccaagaaaactccattgcatctctcgagcatgtgcagcttgaggcaaca
attgagtattcccgtagaggtgatcttcacgtcactctggtatctccatcagggaccacc
actgtcttactggctgagagagagagagataaatctcccaatggctttaagaactgggac
ttcatgtctgttcacacatggggagagaatccaacaggcacctgggttttaagaataact
gatgtgtccagaagaatacaaaatgaaggaaggattgtaaattggaaattgattttgcat
ggcactgctacccagcctgaacatatgaagcagccacgtgtatacacatcctacaatgct
gtgcaaaatgacagaagaggagtggagaagatgacggactttgtagaggaccataccaca
caggagaacctgagtgaaaaacccaaagtcacagaagataccagtagtagcagtgacaaa
gcagaagataaaatcccatcagaggctatgctacatttactgcaaagtgcttttagcaga
cagatgtctcagaagcgattgccaaagaagactgcaagtgagaagttaaatattccatat
gaacacttctatcaagccctcgaaaaattaaacaagcactcccagttgagagactcagaa
gaaagtctctacagtgactacgttgatcttttttacaatgccaaaccatacaagcataga
gatgatagactgctgcaagccttggttgatattataaatgaaggaaactaa

DBGET integrated database retrieval system