KEGG   Nipponia nippon (crested ibis): 104016227
Entry
104016227         CDS       T05756                                 

Gene name
NLK
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04068  FoxO signaling pathway
nni04310  Wnt signaling pathway
nni04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104016227 (NLK)
   04310 Wnt signaling pathway
    104016227 (NLK)
   04068 FoxO signaling pathway
    104016227 (NLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104016227 (NLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104016227 (NLK)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104016227 (NLK)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104016227 (NLK)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 104016227
NCBI-ProteinID: XP_009467346
LinkDB
Position
Unknown
AA seq 526 aa
MSLCGTTANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQXCPXXXXAAAGPAPVGLXPRGPPQPYFPSPAPGQAPGPAAAAPAQVQAAAAAAV
KAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKR
VFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHV
KVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEV
VTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPS
LEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDA
LAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEII
HQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgtctctttgtggcacaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttcctcacctccctcct
cctcacctccatcaccaccaccaccctcaacatcacttgcatccaggctctgcagctgcg
gtgcatcccgtacagcagncctgcccgnnnnnnnnnnnngcggcggccgggcccgcgccg
gtgggattgtaaccccggggccccccccagccatatttcccatcaccggcaccgggtcag
gcccctggaccagctgcagcagccccagctcaggtacaagctgcagcagctgctgcagtt
aaagcgcaccatcatcagcactcacaacatccacaacagcaactggatattgagccggac
agacctattggatacggagcctttggtgttgtctggtcagtaacagatccacgagatgga
aagagagttgcactcaaaaagatgcccaacgtcttccaaaatttggtctcttgtaaaagg
gtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgccctc
gacatactccagcctccacacattgactattttgaagaaatatatgttgtcactgaattg
atgcagagtgacctccataagattatcgtctctcctcagccactcagctcggatcatgtc
aaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatttta
catcgagacattaaaccagggaacctacttgtgaacagcaactgtgttcttaagatttgt
gattttggattggccagggtggaagaattagatgaatctcgtcacatgactcaggaagtt
gtcactcagtattaccgagctccagaaatcctgatgggcagccgtcactacagcaatgct
attgacatctggtctgtaggctgcatctttgcagaattacttgggcgaagaatattgttt
caggcacagagtcccatacagcagctggatttgatcacagacctgttgggaacgccgtcg
ctggaagcaatgaggacggcttgtgaaggcgccaaggcacatatactcaggggtcctcat
aaacagccatcccttcctgtcctgtatacgctttccagtcaagctacacatgaagcagtt
catctcctttgcagaatgttggtctttgatccatccaaaagaatatctgctaaggatgcc
ttagctcacccgtatctcgatgaagggcggttgcgataccacacttgtatgtgtaaatgt
tgtttttccacatctactggaagagtttatactagtgattttgaacccatcactaatccc
aagtttgacgacacttttgagaagaacctcagttctgttcggcaggttaaagaaataatt
catcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccctcag
tctgctgcttttaagagctttattagttccacggtcgctcaaccgtctgagatgccgcca
tctccactggtttgggaatga

DBGET integrated database retrieval system