KEGG   Nipponia nippon (crested ibis): 104016870
Entry
104016870         CDS       T05756                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04110  Cell cycle
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04350  TGF-beta signaling pathway
nni05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104016870 (MYC)
   04012 ErbB signaling pathway
    104016870 (MYC)
   04310 Wnt signaling pathway
    104016870 (MYC)
   04350 TGF-beta signaling pathway
    104016870 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104016870 (MYC)
   04218 Cellular senescence
    104016870 (MYC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104016870 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nni03000]
    104016870 (MYC)
   03019 Messenger RNA biogenesis [BR:nni03019]
    104016870 (MYC)
Transcription factors [BR:nni03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    104016870 (MYC)
Messenger RNA biogenesis [BR:nni03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     104016870 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 104016870
NCBI-ProteinID: XP_009468084
LinkDB
Position
Unknown
AA seq 332 aa
MPCTGALELLPTGCVGSADPLGITPSRGGLSTLAGATWKRLHMHGEDHRLAGGEKHGAEE
GAAMFAASTLGHTVEREVYFGLCFSPRYADKESGPPRCLHFSFALGKSVEKDTGQEKTVR
ILLVALCSGSLMFANIPLGETLLSRKEEQEEDEEIDVVTLAEANESESSTESSTDTSEEH
SKPHHSPLVLKRCHVNIHQHNYAAPPSTKVEYPAAKRLKLDSGRVLKQISNNRKCSSPRT
SDSEENDKRRTHNVLERQRRNELKLSFFALRDQIPEVANNEKAPKVVILKKATEYVLSIQ
SDEHRLIAEKEQLRRRREQLKHKLEQLRNSCA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgccctgcactggtgctctggagctgcttcccacggggtgcgtgggttctgcagatccc
ctgggcatcacgccaagcagagggggactctctacacttgcaggtgcaacatggaagcgg
ctccacatgcatggtgaggatcacaggctggcaggtggcgagaagcatggcgcagaggaa
ggagctgccatgtttgctgcaagcactcttgggcacacagttgagagggaggtgtatttc
ggtctctgtttttcaccacggtacgcagacaaggagagcggccctcccagatgtctgcat
ttctccttcgcgctggggaagtccgttgagaaggacacgggacaggagaaaacggtccga
attttgctcgtagccctctgctccgggagtttgatgtttgcaaatattccgctgggcgaa
acgctgctcagcagaaaagaagaacaagaggaagatgaggaaattgatgttgttacatta
gctgaagcgaatgaatcggaatccagcacagagtccagcacagacacatcagaagagcac
agtaagcctcaccacagcccgctggtactcaaacggtgtcacgtcaacatccatcagcac
aattacgccgctcctccgtccaccaaggttgaatacccagctgcgaaaaggctaaagttg
gacagtggcagagttctcaaacagatcagcaataaccgaaaatgctcaagtccccgcacg
tcagattcggaagagaacgacaagaggcgaacgcacaacgtcttggagcgccagaggaga
aacgagctgaagctgagtttctttgccttgcgtgaccagatacccgaggtggccaacaac
gaaaaggcgcccaaggttgtcatcctgaaaaaagcaacggagtatgttctttccatccag
tcggacgaacacagactgatcgcagagaaagagcagttgaggcggaggagagaacagttg
aaacacaaactcgagcagctaaggaactcttgtgcatag

DBGET integrated database retrieval system