KEGG   Nipponia nippon (crested ibis): 104017045
Entry
104017045         CDS       T05756                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04144  Endocytosis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04350  TGF-beta signaling pathway
nni04371  Apelin signaling pathway
nni04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104017045 (SMAD3)
   04350 TGF-beta signaling pathway
    104017045 (SMAD3)
   04371 Apelin signaling pathway
    104017045 (SMAD3)
   04068 FoxO signaling pathway
    104017045 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104017045 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    104017045 (SMAD3)
   04218 Cellular senescence
    104017045 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104017045 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 104017045
NCBI-ProteinID: XP_009468293
LinkDB
Position
Unknown
AA seq 321 aa
MEMCEYAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTN
FPAGIEPQSNYIPETPPPGYLSEDGETSDHQMNPSMDAGSPNLSPNPMSPAHNNLDLQPV
TYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVE
LTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFN
NQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPL
QWLDKVLTQMGSPSIRCSSVS
NT seq 966 nt   +upstreamnt  +downstreamnt
atggagatgtgcgagtatgcctttaacatgaagaaggatgaagtctgtgtgaacccttat
cattaccaaagagtggaaaccccagtgttacctccagtgctggtgcctcggcacacagag
atcccagctgaattcccgccattagatgattatagtcattctattccagagaacactaac
ttcccagcaggtatcgagccacagagcaactacattccagagacacctcctccaggctat
ttgagtgaggatggagaaactagtgaccaccagatgaatcccagcatggatgcaggttct
ccaaacttatcaccaaaccctatgtctccagcacacaataacctggatctgcagcctgtt
acctactgtgagccagctttctggtgctcgatatcctactatgaactcaaccagcgagtg
ggagagactttccatgcctctcagccctctatgactgtggatggtttcactgacccatct
aattctgaacgcttctgccttggtttactgtctaacgtgaacagaaatgcagcagtggaa
ctcacaagacgacacatcggaagaggagtaagactctactacattggcggcgaggtgttt
gccgagtgccttagtgacagtgccatttttgtccagtctcccaactgcaaccagcgctac
ggctggcacccggcgacagtttgcaagattccaccaggatgtaacttgaagatttttaac
aaccaggaattcgccgctctcttggctcagtctgtaaatcagggcttcgaagctgtgtat
cagctgaccagaatgtgcacaattcggatgagcttcgtcaagggatggggagcagaatac
aggcggcagactgtgaccagtactccctgctggattgaactgcatcttaacggtcctttg
cagtggctagacaaggtcctcacacaaatgggctccccgagtattcgttgttccagtgtc
tcctaa

DBGET integrated database retrieval system