KEGG   Nipponia nippon (crested ibis): 104017047
Entry
104017047         CDS       T05756                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04114  Oocyte meiosis
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04510  Focal adhesion
nni04540  Gap junction
nni04620  Toll-like receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04914  Progesterone-mediated oocyte maturation
nni04916  Melanogenesis
nni05132  Salmonella infection
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104017047 (MAP2K1)
   04012 ErbB signaling pathway
    104017047 (MAP2K1)
   04370 VEGF signaling pathway
    104017047 (MAP2K1)
   04371 Apelin signaling pathway
    104017047 (MAP2K1)
   04068 FoxO signaling pathway
    104017047 (MAP2K1)
   04150 mTOR signaling pathway
    104017047 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104017047 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104017047 (MAP2K1)
   04210 Apoptosis
    104017047 (MAP2K1)
   04218 Cellular senescence
    104017047 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104017047 (MAP2K1)
   04540 Gap junction
    104017047 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104017047 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104017047 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104017047 (MAP2K1)
   04912 GnRH signaling pathway
    104017047 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    104017047 (MAP2K1)
   04916 Melanogenesis
    104017047 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104017047 (MAP2K1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104017047 (MAP2K1)
  09172 Infectious disease: viral
   05164 Influenza A
    104017047 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104017047 (MAP2K1)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104017047 (MAP2K1)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: STE group
  STE7 family
   104017047 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like NAD_binding_6
Other DBs
NCBI-GeneID: 104017047
NCBI-ProteinID: XP_009468296
LinkDB
Position
Unknown
AA seq 389 aa
MELWQRRSALTVKKQLQDCSRTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDD
DFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYI
VGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKI
MHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDI
WSMGLSLVEMAIGRYPIPPPDSKELELMFGCPVEGDSPVTETSPRQRTPGRPVSSYGPDS
RPPMAIFELLDYIVNEPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIHAFIKRS
EAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggaactctggcaaaggcgtagcgctttgacagtgaaaaaacaactccaagactgcagc
agaacaaatttggaagcacttcagaagaagctggaagaactagagttggatgaacagcag
cggaagcgccttgaagctttccttacccagaaacaaaaagttggagagctgaaggatgat
gactttgagaagatcagcgagctgggagcaggaaatggaggtgtggtcttcaaagtatct
cacaagccttctggtctcataatggcaagaaagttaattcatctagagatcaagccggct
attcgaaaccagatcattcgtgagctgcaagttctacatgagtgcaactctccatacata
gtgggcttttatggagctttttacagtgatggagaaatcagtatttgcatggaacatatg
gatggcggctccttggatcaagtactgaaaaaggctggaaggattccagagcagatactg
ggcaaagttagcattgcggtaataaaaggactcacatatctgagagaaaagcataaaata
atgcacagagatgttaaaccatctaacattttggtaaactctagaggtgaaatcaagctt
tgtgattttggtgtcagtggacaactgatagattctatggcaaactcgtttgttggcaca
cgctcctacatgtctccggaaagattacagggaactcactattcagtgcaatcggatata
tggagtatggggttgtcactggtagaaatggctattggcagatacccgattcctccccct
gactctaaggagcttgaattaatgtttggctgcccagtagagggagattctccagtcacc
gagacctcgcccaggcaaagaacacctggtcgaccagtgagctcctatggaccagacagc
agacccccaatggcaatctttgaacttcttgattacatcgtcaatgagccacctccaaaa
ctgcccaatggtgtgtttggttcggaatttcaagattttgttaacaaatgtttaattaaa
aatcctgctgagagagcagatctgaagcagctgatgatccatgctttcattaagagatct
gaagcggaggaggtggattttgcggggtggctttgttcaaccataggccttaaccaaccg
agcacgcccacgcatgctgctggagtctga

KEGG   Nipponia nippon (crested ibis): 104018809
Entry
104018809         CDS       T05756                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04012  ErbB signaling pathway
nni04068  FoxO signaling pathway
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04210  Apoptosis
nni04218  Cellular senescence
nni04270  Vascular smooth muscle contraction
nni04370  VEGF signaling pathway
nni04371  Apelin signaling pathway
nni04540  Gap junction
nni04620  Toll-like receptor signaling pathway
nni04810  Regulation of actin cytoskeleton
nni04910  Insulin signaling pathway
nni04912  GnRH signaling pathway
nni04916  Melanogenesis
nni05132  Salmonella infection
nni05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104018809 (MAP2K2)
   04012 ErbB signaling pathway
    104018809 (MAP2K2)
   04370 VEGF signaling pathway
    104018809 (MAP2K2)
   04371 Apelin signaling pathway
    104018809 (MAP2K2)
   04068 FoxO signaling pathway
    104018809 (MAP2K2)
   04150 mTOR signaling pathway
    104018809 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104018809 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    104018809 (MAP2K2)
   04218 Cellular senescence
    104018809 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104018809 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104018809 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104018809 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104018809 (MAP2K2)
   04912 GnRH signaling pathway
    104018809 (MAP2K2)
   04916 Melanogenesis
    104018809 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104018809 (MAP2K2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104018809 (MAP2K2)
  09172 Infectious disease: viral
   05164 Influenza A
    104018809 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104018809 (MAP2K2)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104018809 (MAP2K2)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: STE group
  STE7 family
   104018809 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 APH Kdo
Other DBs
NCBI-GeneID: 104018809
NCBI-ProteinID: XP_009470266
LinkDB
Position
Unknown
AA seq 389 aa
MGSVRGRQSIAWGCWVEGVGANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDD
FERISELGAGNGGVVTKVQHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIV
GFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIM
HRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIW
SMGLSLVELSIGRYPIPPPDSKELEAIFGRPVVDGAEGESHSISPRARPPGRPVSGHGMD
SRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADLKMLMSHTFIKR
SEVEEVDFAGWLCKTLRLNQPSTPTRAAM
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgggcagtgttaggggacggcagagcatcgcgtgggggtgctgggtggaaggggtgggg
gcaaacctggtggaccttcagaaaaagctcgaggaactggagctggacgagcagcaaaag
aagcgcctggaagctttcctcacgcagaaagccaaagtgggcgagctgaaggacgatgac
tttgagcggatctctgaattgggggctggcaatggcggtgtggtcaccaaagtgcagcac
aaaccttcagggctcgttatggcacggaagctgattcatttagaaatcaaaccggccatc
aggaatcagattatccgagagctgcaggtgctgcatgagtgtaattccccatatatcgtg
ggtttctatggagccttctacagcgacggagagatctccatctgcatggagcacatggat
ggtggctctttggatcaagtgttgaaagaagccaaaagaattcccgaggagatcttgggg
aaagtcagtatagcggttctgagaggcttagcgtatctgagagagaagcaccaaatcatg
cacagagatgtgaagccttctaacatcctggttaattctcgaggagagattaagctgtgt
gattttggggtcagcggtcaacttattgactccatggcaaactcttttgtgggaactcgg
tcctacatgtctcccgagcggttgcagggcacccactactcagtccagtccgacatctgg
agcatgggtctgtcgttagtggagctgtctatcggaaggtacccaatccccccgccagac
tccaaggaactggaagcaatatttggccgtcctgtggtggacggggcagagggagagtct
cacagcatctcgccgcgggccaggcccccaggacgccccgtcagtggacatgggatggac
agccggcctgcgatggccatctttgaactgctggattatatagttaatgagccacctccc
aagctgccgaacggagttttcacgcaagatttccaggagtttgtaaataaatgcttaatt
aaaaatccagcggaacgggcagatctgaagatgctgatgagtcacaccttcatcaaacgc
tccgaagtggaggaggtggattttgccggctggctgtgcaaaacgctgcggttgaaccag
cccagcacgcccacccgcgctgccatgtga

DBGET integrated database retrieval system