KEGG   Nipponia nippon (crested ibis): 104017148Help
Entry
104017148         CDS       T05756                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
nni  Nipponia nippon (crested ibis)
Brite
KEGG Orthology (KO) [BR:nni00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104017148 (MAPK6)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104017148 (MAPK6)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104017148 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 104017148
NCBI-ProteinID: XP_009468427
UniProt: A0A091VH41
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEKEREKNQGFDFDSFIAETIQLS
LQHESTDVDKLNDLNSSVSQIELKGLISKSVSREKQEKGMANLAQLEALYQTSWDSQFVS
SGEECFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKERE
ESFLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILK
HLN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggtggaaatggcttagttttttctgctgtcgataat
gactgtgacaaaagagtggctgtcaagaaaattgtccttacagatccccagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaagta
tttgaaattcttggtcctagtggaagccagctaacagatgatgtgggctcccttacagaa
ttgaactgtgtttacattgtccaggaatacatggagacagatctggctaatctgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaatgttctgcatagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagattggcgactttggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttactaaatggtacagatcgccc
cgtcttttgctttctcctaacaactacactaaagccattgatatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcgcatgaacttgaacag
atgcagttgattctagaatcaattcctgttgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcgctggactttctggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttacatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctgatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctttctgatgttactgatgaggaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtatctggaggatcctgcctttgacacccacttctct
actgagccttgctggcagtattcggatcaccatgaaaacaagtattgtgatctggaatgt
agtcacacttgtaattacaaaatgaggtcatcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcgaactggaag
gaacagagcaaagaaaagtctgataagaaaggcaagtctaaatgtgaaaagaatgggttg
gtgaaagctcagatagcacttgaggaagcatcacagcagcttgttgaaaaagaaaaagaa
agggagaagaatcaaggatttgactttgattcatttatagcggaaaccattcagcttagt
ttacaacatgagtctactgatgttgataaattaaatgacttgaatagctcagtgtctcaa
atagagttgaaaggattaatatcaaagtcagtaagcagagagaagcaggagaaaggaatg
gcgaatctggcacagttagaagctctgtaccaaacttcttgggacagtcagtttgtaagt
agtggggaggagtgcttcctcatagaccagttttgttgcgaagtaaggaaagatgagcaa
gttgaaaaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagat
gctgaaatgctagaacctgagccagtagaagaggggaagcttggggagaaggaaagagaa
gagagctttctcagtaacagtggagaactcctcttcaacaagcagcttgaggctataggt
attcctcagtttcacagccctgttggttcaccactgaaatcaatacaggccacgttaaca
ccttctgctatgaaatcgtctccccaaattccccacaaaacgtacagcagcattctgaaa
catctaaattaa

DBGET integrated database retrieval system