KEGG   Nipponia nippon (crested ibis): 104017516
Entry
104017516         CDS       T05756                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04114  Oocyte meiosis
nni04115  p53 signaling pathway
nni04218  Cellular senescence
nni04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104017516 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104017516 (CDK2)
   04114 Oocyte meiosis
    104017516 (CDK2)
   04115 p53 signaling pathway
    104017516 (CDK2)
   04218 Cellular senescence
    104017516 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104017516 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104017516 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nni03032]
    104017516 (CDK2)
   03036 Chromosome and associated proteins [BR:nni03036]
    104017516 (CDK2)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104017516 (CDK2)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104017516 (CDK2)
DNA replication proteins [BR:nni03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104017516 (CDK2)
Chromosome and associated proteins [BR:nni03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104017516 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DAGK_acc APH
Other DBs
NCBI-GeneID: 104017516
NCBI-ProteinID: XP_009468825
LinkDB
Position
Unknown
AA seq 349 aa
MKNKLWYLEFATSETIFATCKKLKECLSVECCGTPLDLSGALAGLAVLNIPSMHGGSNLW
GETKAVGPPGPVGGPVSVGSCVCGDPRGHGRPRVRGEPWPRAPRVRGAPHGAGPGGARSP
RLLDVIHTENKLYLVFEFLHQDLKKFMDSSSLSGIALPLIKSYLFQLLQGLAFCHAHRVL
HRDLKPQNLLINADGAIKLADFGLARAFGVPVRTYTHEGISCGSAGPGPPAAGVGLGWIP
RVCVGLAICARRLQREAARRRSGAWIPPGRTGSFAGVATGHLLRQCRPRTPGRGRRAGLD
PSSLRGTCYLCQAPAARGGSAPERSLDPSWEDGKLCRGGLERASVLSRV
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaagaacaagctgtggtacctcgagttcgccacctccgagaccatcttcgccacctgc
aagaagctcaaggagtgcctgagcgtggagtgctgcgggacccccctggacctgagcggg
gccctggcggggctggcggtgctgaacatccccagcatgcacggaggctccaacctctgg
ggcgagaccaaggccgtggggccccctgggcccgtgggtggccccgtgtccgtggggagc
tgtgtctgcggggacccccgtggccatgggcggccccgtgtccgtggggagccgtggcca
cgggccccccgtgtccgtggggcgccccacggcgccggcccaggcggtgcccgctccccc
aggctgctggacgtgatccacacggagaacaagctctacctggtcttcgagttcctgcac
caggacctgaagaagttcatggactcgtcctccctcagcggcatcgccctgcccctcatc
aagagctacctgttccagctgctgcagggcctggccttctgccacgcgcaccgcgtgctg
caccgcgacctcaagccccagaacctgctcatcaacgccgacggcgccatcaaactggcc
gacttcggcctggcccgcgccttcggggtgcccgtgcgcacctacacccacgagggcatc
tcctgcggcagtgccggccccggacccccggccgcgggcgtcgggctgggctggatccct
cgagtctgcgtgggacttgctatttgtgccaggcgcctgcagcgagaggcggctcggcgc
cggagcggagcctggatccctcctgggaggacgggaagctttgccggggtggccacaggg
catctcctgcggcagtgccggccccggacccccggccgcgggcgtcgggctgggctggat
ccctcgagtctgcgtgggacttgctatttgtgccaggcacctgcagcgagaggcggctcg
gcgccggagcggagcctggatccctcctgggaggacgggaagctttgccggggtggcctt
gagcgcgcgtcggtgctatcgcgggtgtga

DBGET integrated database retrieval system