KEGG   Nipponia nippon (crested ibis): 104017979
Entry
104017979         CDS       T05756                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04370  VEGF signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104017979 (PPP3CB)
   04310 Wnt signaling pathway
    104017979 (PPP3CB)
   04370 VEGF signaling pathway
    104017979 (PPP3CB)
   04020 Calcium signaling pathway
    104017979 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104017979 (PPP3CB)
   04218 Cellular senescence
    104017979 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104017979 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104017979 (PPP3CB)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104017979 (PPP3CB)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104017979 (PPP3CB)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 104017979
NCBI-ProteinID: XP_009469375
LinkDB
Position
Unknown
AA seq 439 aa
MIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLK
ILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLPLAALLNQQFLC
VHGGLSPEINTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNENSQEHFSHNTVRGCS
YFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDEL
MTEGEDQFDVGTAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGV
LAGGRQTLQSATVEAIEAEKAIRGFSPQHKICSFEEAKGLDRINERMPPRKDALQQDGIN
TINTTNANGNNGTGNNNAQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgatagaagttgaagcgccaattacagtgtgtggtgatattcatggccagttctttgat
ctaatgaagctgtttgaagtgggaggatcacctgctaacacaagatacctcttcctcggt
gactatgtagacagaggttattttagtatagagtgtgtgctgtacttatgggtcctgaaa
attctctacccaagcacgttatttcttttgagaggcaaccatgaatgcagacatctaaca
gagtattttacctttaagcaagaatgtaaaataaagtactcggagagagtctacgatgct
tgtatggaagcttttgattgtctccctcttgctgctcttttaaatcaacagtttctttgt
gttcatggtggactttcaccagaaattaatacactagatgacattaggagattagataga
ttcaaagagcctccagcatttggaccaatgtgtgacttattgtggtcagatccttcagaa
gattttggaaatgaaaattcacaagagcatttcagtcacaatacagtcagaggatgctca
tacttttatagctatccagcagtttgtgaatttttgcaaaataataatttattgtcaatc
attagagcacatgaagcacaagatgcaggttatagaatgtacaggaaaagtcaaactaca
gggttcccatcattaataacaattttttcagcacctaattacctggatgtctacaataat
aaagctgctgtattaaagtatgaaaacaatgtgatgaatattcgtcagttcaattgttct
cctcatccttactggctaccaaattttatggatgttttcacatggtctttgccatttgtt
ggagaaaaagtaacagaaatgttggtgaatgttttgagcatttgctctgatgatgaactg
atgacagagggagaagatcaatttgacgtaggtacagctgccgcacggaaagaaataatc
agaaacaaaattcgtgcaattggcaagatggcaagagtcttctctgttctcagggaggag
agtgaaagtgtgctgacactcaagggtttgactcccactggaatgttacctagtggagtg
ttggctggaggacgacagaccctgcaaagtgccactgtagaggcaattgaggctgaaaaa
gcaatacgaggattctctccgcaacataaaatctgcagttttgaagaagcaaaaggtttg
gataggatcaatgagagaatgccaccaagaaaagatgctcttcagcaagatggtattaat
actataaacacaacaaatgccaatggaaacaatgggactggcaacaacaatgcacagtga

KEGG   Nipponia nippon (crested ibis): 104018925
Entry
104018925         CDS       T05756                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04370  VEGF signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104018925 (PPP3R1)
   04310 Wnt signaling pathway
    104018925 (PPP3R1)
   04370 VEGF signaling pathway
    104018925 (PPP3R1)
   04020 Calcium signaling pathway
    104018925 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104018925 (PPP3R1)
   04218 Cellular senescence
    104018925 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104018925 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104018925 (PPP3R1)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     104018925 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 104018925
NCBI-ProteinID: XP_009470410
LinkDB
Position
Unknown
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcgcactttgatgctgatgagataaaacgactaggaaagagattcaagaagctt
gatttggacaactctggttctttgagtgtggaagagttcatgtctttacctgaattgcaa
cagaacccattagtacagcgagtaatagatatatttgacacagatggaaatggagaagtg
gacttcaaagaatttatagaaggagtctcccagttcagtgtcaaaggagataaggaacag
aagttgaggtttgcttttcgcatttatgatatggacaaagatggttatatctcaaacgga
gagctcttccaagtgctgaagatgatggttgggaacaatctcaaagacactcagttacag
caaattgtagataaaaccataattaatgcagataaggatggtgatggaagaatatccttt
gaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatggtcgtagatgtg
tga

KEGG   Nipponia nippon (crested ibis): 104019551
Entry
104019551         CDS       T05756                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04370  VEGF signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104019551 (PPP3CC)
   04310 Wnt signaling pathway
    104019551 (PPP3CC)
   04370 VEGF signaling pathway
    104019551 (PPP3CC)
   04020 Calcium signaling pathway
    104019551 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104019551 (PPP3CC)
   04218 Cellular senescence
    104019551 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104019551 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104019551 (PPP3CC)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104019551 (PPP3CC)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104019551 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 104019551
NCBI-ProteinID: XP_009471091
LinkDB
Position
Unknown
AA seq 502 aa
MDLLRGRHQVCSVPFPPTQRLTLKEVFEDGKPRLDVLKSHLVKEGRLEEDAALKIINDGA
AILRHEKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPNNTRYLFLGDYVDRGYFSIEC
VLYLWSLKINHPKTLFLLRGNHECRIKYSERVYDACMDTFDCLPLAALLNQQFLCVHGGL
SPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPSEDYGNEKTLEHFAHNTVRGCSYFYSY
PAVCEFLQNNSLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVL
KYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELISDGD
ETLEDHYISSYQKGGTTVRKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLP
LGVLSGGRQTLQTATVEAVEAREAIRGFSPQHKIRSFEEARGLDRINERMPPRKDSMHSD
GPVNLVTSTNSADKNGTGKKAQ
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggacctgttgagaggaagacaccaggtttgctctgtcccatttcctcccacgcagcgg
ctcactctgaaggaggtgtttgaggatgggaagcctaggcttgacgtcttgaagagccac
ttggtaaaggaagggcgcctggaagaggatgcggcgctgaagatcatcaacgatggggcc
gccatccttaggcacgagaagacaatgattgaagtggaggctccgatcacagtgtgcggt
gacattcatgggcagttttttgacctgatgaagttgtttgaagttggaggatcacccaat
aacacccgctacctcttcctgggagactacgtggacagaggctacttcagtatagagtgc
gtgctgtatttatggagtttaaagataaatcatcccaaaacattgttcctccttcgaggg
aaccatgagtgtcgaatcaagtattcggagcgagtgtacgatgcgtgtatggatacattt
gactgtcttcctcttgctgccctcttaaaccagcaatttctgtgtgttcatggaggactg
tctccagaaatcacgtgtctagatgacattaggaaattagacaggtttaaggagcctccg
gccttcggtccaatgtgtgacctgctctggtccgatccatcagaggattacggcaatgag
aaaacgctggagcatttcgcccacaacaccgttcgaggctgctcctatttctacagttat
cctgcagtttgtgaatttttgcagaacaatagtttgttatctgtaatccgagctcacgaa
gcccaggacgctgggtaccgaatgtacaggaagagccagacaacaggctttccatcatta
atcacaatcttctctgcaccaaattacctagatgtctataacaacaaggctgctgtactg
aaatacgaaaacaacgtcatgaacatcaggcagttcaactgttcccctcatccgtactgg
cttccaaacttcatggatgtcttcacatggtctttgccttttgtaggggaaaaggtcaca
gaaatgctcgttaacatcctcaacatatgctccgacgatgagttgatttcagatggtgat
gagacattggaagatcactacatttcaagctatcagaaaggtgggacaacagtccgtaaa
gagatcatcaggaataagattagagccattgggaagatggcgcgtgtcttctcggttctt
cgagaggagagcgagagcgtgctgactctcaaaggcctgactcccacaggtacactgccc
ctgggagtgctctcaggggggaggcagaccctacagactgccacagtagaagcggtagag
gcacgggaagccattcgtggattttcaccgcagcacaagatccgcagcttcgaagaagcc
agaggtctggatcgcattaacgaacgcatgccgccacgcaaagattcaatgcactcagac
gggccggtgaacttggtaacctcaacaaactctgcggacaagaatggcacagggaagaaa
gcccagtaa

KEGG   Nipponia nippon (crested ibis): 104021326
Entry
104021326         CDS       T05756                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04020  Calcium signaling pathway
nni04114  Oocyte meiosis
nni04218  Cellular senescence
nni04310  Wnt signaling pathway
nni04370  VEGF signaling pathway
nni04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104021326 (PPP3CA)
   04310 Wnt signaling pathway
    104021326 (PPP3CA)
   04370 VEGF signaling pathway
    104021326 (PPP3CA)
   04020 Calcium signaling pathway
    104021326 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104021326 (PPP3CA)
   04218 Cellular senescence
    104021326 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104021326 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104021326 (PPP3CA)
Enzymes [BR:nni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104021326 (PPP3CA)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     104021326 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 104021326
NCBI-ProteinID: XP_009473142
LinkDB
Position
Unknown
AA seq 613 aa
MGDTVTDVNYFPVPRETRSKSCRLPAGDKEPFTPHVWPWRLSLLESLRRRWGWTGPSSKA
EGRNLRPPFGKLPFASPVRRARGHAAGEADSRRTSRNNASKARLSLLERSVLAVPFPPSH
RLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTV
CGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLL
RGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIN
TLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCE
FLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN
VMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGTEEDGFDGA
TAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSA
TVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDVPSDANLNSINKAISTETN
GTDSNGSNSSNIQ
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgggggacaccgtcacagatgtaaattactttccagtccccagagaaacacgaagtaag
agttgtcgtcttccagccggggacaaggaacccttcacaccccacgtctggccatggcgc
ttgtccttgctggagagtttgaggagacggtggggctggacgggccccagcagcaaggcc
gagggccgcaacctgcgcccgcccttcggcaagctgcccttcgcgagcccggtgcgccgg
gcaaggggacacgcagcgggggaggcggacagccgtcgtacatcaagaaataatgctagc
aaggctcgtctcagtcttctagagaggtctgtcttggctgtcccatttcctccaagtcac
cggctcacagctaaggaagtgtttgataatgatggaaaaccccgtgtggatatcttaaag
gcacaccttatgaaagaagggagactggaagagagcgttgctttgagaataataacagaa
ggagcttcaattctccgccaggaaaaaaatttgctcgacatagatgcaccagtcacagtt
tgtggagacatccatggtcagttctttgacttgatgaaactttttgaagtgggaggttct
cctgccaacacgcggtatctcttcctgggggactacgtggacagagggtacttcagcatt
gaatgtgtgctgtacttgtgggccttgaaaatcctttaccccaaaacactgtttttactt
cgtgggaatcatgaatgtagacatttaacagagtatttcacatttaagcaagaatgtaaa
atcaaatattcagaacgtgtatatgatgcctgcatggatgccttcgactgccttcccttg
gctgctctgatgaaccaacaattcctgtgtgtacatggtggcttgtctccagagatcaac
accttagatgacatcagaaaattagatcgattcaaggaaccacctgcgtacggacctatg
tgtgacatcctgtggtcagacccgttggaggactttggaaatgagaagactcaggaacac
tttactcacaacacagtcagggggtgctcgtacttctacagttaccctgctgtatgtgaa
ttcctacagcataataacttgttatctatactccgagctcatgaagcccaggatgctggg
tatcgtatgtacaggaaaagccaaacaacaggcttcccttcactaatcacaattttttca
gcaccaaactatctagatgtatacaataacaaagctgcagtattgaaatatgagaacaac
gttatgaatatcagacagttcaactgctcccctcatccgtactggcttccgaatttcatg
gatgtgtttacctggtccttgccatttgtgggtgagaaagtgacagagatgctggtaaat
gtgctgaacatctgctcagatgatgaattggggacagaggaagatgggtttgatggagca
acagctgctgctcgaaaggaggttataaggaacaagataagagcaataggaaaaatggct
agagttttctcagtgttaagagaagagagcgaaagtgtgctgacgctgaaaggtttgact
ccaacaggaatgctgcccagtggtgtgctctctggaggaaaacaaacactgcaaagcgct
actgttgaggctattgaggctgatgaagctatcaaaggattttcaccccagcataagatc
actagcttcgaagaggccaaaggcttagatcgaattaatgagcgaatgcctccgcgcaga
gacgtgccatccgatgccaaccttaactccatcaacaaggcaatctccacagagactaat
ggcacggacagcaacggcagtaatagcagcaatattcagtga

DBGET integrated database retrieval system