KEGG   Nipponia nippon (crested ibis): 104018900Help
Entry
104018900         CDS       T05756                                 

Gene name
MAP3K14
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04210  Apoptosis
nni04625  C-type lectin receptor signaling pathway
nni04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104018900 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104018900 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104018900 (MAP3K14)
   04672 Intestinal immune network for IgA production
    104018900 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104018900 (MAP3K14)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104018900 (MAP3K14)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: STE group
  Other
   104018900 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104018900
NCBI-ProteinID: XP_009470384
LinkDB All DBs
Position
Unknown
AA seq 945 aa AA seqDB search
MAVMGITCQGAPDPAVKHKKELTATKGLNETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTKKKRHKKRSKLKVQTVAAGRQGPRTPEQESCTPIPVQED
ESHQNTLYRNNFWVSELNKDLAYDPLPFEKPEKVLSAGKLHSPRSQYKTELHKLISPIQC
LNHVWKRHYQRDSVPQPETLHPFPXXIIPPHFPHLDSPLHAMKLNALKTYFHGDLNYQES
EHRFSGLNLEYSFPKCVNQSMKTSLDKISVEEYLVDALKGSVSLGEPQNLASLAKTWKGG
GLDPKEQFHEADENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTS
PWKGEYREPRHLSLSKENNPQTSLSPTVSPVSETGSDPKLPVKVSCVSPVLPPPSLEQTE
EVEGTPWNVCKELSETWDPPPLSSTPLPLKSCGHVERATTISEQELQQLEIELFLNSLSQ
PYSLEEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQTDGQSFSXQT
AXXXXXXXHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLV
TKEGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccaaggagctcctgatccagccgtcaagcacaagaag
gagctcacagctaccaaggggctgaacgagacagttagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgctcatagtaagcgttacagccggtcagacagtctcgaccaaatccctaacaatgtg
gcccacgcaacggaggggaagatggcacctacctgttggagggggaggcatcgtggtaag
acgaaaaagaaacgtcacaagaaaagatccaagctgaaagtacaaacagtggctgctggc
aggcaaggtcccagaactccagaacaagagagctgcaccccaattcccgtccaggaggat
gaatcacaccaaaatactctttacagaaacaatttttgggtttcagaacttaacaaggac
ttggcctatgacccgctgccgtttgagaagcccgagaaagttctgtccgcgggcaaactc
cattcaccaaggagccagtacaaaacagaactgcacaagttgataagccctattcagtgc
cttaatcatgtttggaaacggcactatcagagggacagtgttccacagcctgaaactctc
catccttttccnnnnnncataataccccctcatttcccacatctggacagtcctctccat
gccatgaaacttaatgctctgaagacgtacttccatggtgacctcaactatcaagaaagt
gagcatcgcttctctggcctaaacttagaatacagtttccccaaatgcgtcaaccagtcc
atgaaaaccagtttggacaagatttctgtggaagaatacttggtggatgccttgaagggg
agcgtgagtcttggtgaaccacagaatttagccagcctagccaagacgtggaaaggaggt
ggtctggacccgaaggaacaatttcatgaagcagatgaaaatgaaggcgtgctacttaat
gagaaactaaagccggtggattatgagtaccgagaagaggttcactggaccaagtgtcac
ggttctttgggcattggctcttttggagaagtatacaaaattgaggacaaacagacggga
tttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgcagaggagttaacgacg
tgtgctgcaataacaagtcctaaagttgtccccttgtatggagctgtgaaggaaggacct
tgggtgaccatcttcatgaagctgatggagggtggctcactaggtcagctaattaaacag
agcggctgcctgccagaggacagagccctcagttatttgggccaggcattagagggtttg
gagtatcttcacgcgcaaaacattctccatggagatgtaaaagcggaaaacgtgctcttg
tctgatgatggaagcagggctcttctgtgtgactttggtcactctgctcaccttcatcca
gatggcctgggaaagtgcttggtcacagggaactatgtgcctggcacggagactcacatg
gctccagaggtggtcatgggaaagcgttgtgactccaaagtggatgtctggagcagctgc
tgtatgatgttgcacatgcttaatgggtgccacccttggacccagtattacaatcacccg
ctctgtctaaagatagctaaagagccacctcctctgagggaaattccaccttcctgcaac
cctctcactgctgagattattaaaatgggtctggagaaagagcctgttcaaagagcatct
gcgtctgaactgaaaactaagaccagcgtcgcacttgaagaagtgggaggtgtaacaagt
ccctggaaaggcgaatacagagagcctagacatttatctttgagcaaagaaaacaatcca
cagacgtccctgtcccccacagtgagcccagtttctgagactggttccgacccaaaattg
ccagtcaaagtttcttgtgtgagcccagtcctaccaccaccgtctctggagcaaacagag
gaggttgagggaaccccttggaacgtgtgcaaggaattatctgagacctgggatcctcca
cctctctcctcgactcctcttcccctgaagagctgtggccatgtggagagagcaaccacc
atttcagaacaagagcttcagcagctggaaatagaactgtttttgaacagcctttcacag
ccttactcgctggaagagcaagaacaaatgctttcgtgcctcagcatcgacagcccgttt
gtgtcagatgccagtgagaagaactccatgaaggcttctcatagcttgagggacactatg
agctctgggattcattcctggaacagccagacagatggacagagcttcagttgacaaact
gctnnnnnnnnnnnnnnnnnnnnncacacagacactcccagctatttcaacggagtgaaa
atccagatccagttgctaagtggagaaaatttacacatcagggatttccacaggacaaag
gtgggagacattgccactgggataagcagccagataccagtccctgctttcagtctggtt
actaaagaaggccagccagttcactacgacatggaggtccccgactctggtattgagctg
cagtgcacccttgcccctgactgcagcgtcagctggacatggcgagtcaaacacggtcag
ctggagaacagaccatga

DBGET integrated database retrieval system