KEGG   Nipponia nippon (crested ibis): 104019088
Entry
104019088         CDS       T05756                                 

Gene name
TRPV4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nni00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104019088 (TRPV4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nni04040]
    104019088 (TRPV4)
Ion channels [BR:nni04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   104019088 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 104019088
NCBI-ProteinID: XP_009470591
UniProt: A0A091ULE4
LinkDB
Position
Unknown
AA seq 863 aa
MADAEDPPHAIGGDAGEGPGDDGSLQNDSFPLSSLANLFESEDTPSPAEAARSPPGAGDG
KQNLRMKFQGAFRKGAPKPMELLEATIYESAVVPAPKKAPMDSLFDYGTYRHHPSENKRW
RRRVAEKQAPGAKGPAPNPPPVLKVFNRPILFDIVSRGSPAGLDGLLSFLLTHKKRLTDE
EFREPSTGKTCLPKALLNLSGGRNDTIPLLLDIAEKTGNMREFINSPFRDVYYRGQTALH
IAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHIVHY
LTENGHKQADLRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLVKCAKLFPDTNLE
ALLNNDGLSPLMMAAKTGKIGIFQHIIRREITDEDARHLSRKFKDWAYGPVYSSLYDLSS
LDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYISVVSYLCAMV
IFTLVAYYRPMEGPPPYPYTTTVDYLRLAGEIITLLTGILFFFTNIKDVFMKKCPGMNSF
FIDGSFQLLYFVYSVLVIITAGLYLGGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYS
IMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCPSSESCSEEQSNCTVPTYPSCRDS
QTFSTFLLDLFKLTIGMGDLEMLESAKYPGVFIILLVTYIILTFVLLLNMLIALMGETVG
QVSKESKHIWKLQWATTILDIERSFPVFLRRAFRSGEMVTVGKGTDGTPDRRWCFRVDEV
NWSHWNQNLGIISEDPGKNDTYQYYGFSHTMGRLRRDRWSTVVPRVVELNKSCQPDEVVV
PLGTVGTAEARERRHGQASSSPL
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggcagacgccgaagaccccccccacgccattggcggcgatgccggcgagggcccaggg
gatgacgggtccctccagaatgactccttccctctctcctcgctggccaacctgttcgag
agcgaggacaccccgtcccccgctgaggcagcccgcagtccccccggtgctggggatgga
aagcaaaaccttcgcatgaaattccaaggggccttccggaaaggtgccccaaagcccatg
gagctgctggaggccaccatctatgagtcggctgtggtccccgcgcctaagaaagccccg
atggactccctcttcgactatggcacctaccgccaccaccccagcgagaacaagcgctgg
cgtaggagggtcgcggagaagcaggcaccaggtgcgaagggaccggctcccaacccaccc
cctgtcctcaaggtcttcaacagacccatcctctttgacatcgtctcccgggggtccccc
gcgggcctggacgggctcctctccttcctcctcacccacaagaagcgcctgacagatgag
gagtttcgagagccctccacggggaagacctgcctgcccaaggcgctgctcaacctgagc
gggggcaggaacgacaccatccccctcctcctcgacatcgctgagaagacaggcaacatg
cgggagttcatcaactcgcccttcagggatgtctactaccgaggtcagacagccctgcac
attgccattgagcgccgctgcaagcactacgtggagctgctggtggagaaaggagcagat
gtgcacgctcaggcccgtggccgcttcttccagcccaaggatgagggcggctacttctac
ttcggtgagctgcccctctcgctggctgcctgcaccaaccagccccacatcgtgcactac
ctgacggagaacgggcacaagcaggcagatctgcggcgccaggattctcgcggcaacacc
gtgctgcacgccctggtcgccatcgccgacaatacccgcgagaacaccaagtttgtcacc
aaaatgtacgacctgctcctcgtcaagtgcgccaagctcttccccgacaccaacctggag
gcgctgctcaacaacgatggcctctcccccctcatgatggctgccaagactggcaagatt
gggatcttccagcacatcatccggcgggagatcacggatgaggacgcccggcacctctcg
cggaagttcaaggactgggcgtacggccccgtctactcctccctctacgacctctcctcg
ctggacacctgcggggaggaggtgtctgtgctggagatcctcgtctacaacagcaagatt
gagaaccgccacgagatgttggctgtggagcccatcaatgagctgctgcgtgacaagtgg
cgcaagtttggggccgtctccttctacatcagcgtggtttcctacctctgcgccatggtc
atcttcaccctcgtcgcctattaccgccccatggaaggcccccccccctacccgtacacc
accaccgtcgactacctgcgcctggccggggagatcatcacccttctcactggcatcctc
ttcttcttcacaaatatcaaagatgtgttcatgaagaagtgcccaggcatgaactccttc
ttcatagacggctccttccagctcctctacttcgtctactcggtcctggtgatcatcacg
gcggggctgtacctgggcggcatcgaggcgtacctggccgtcatggtcttcgcactggtc
ctgggctggatgaatgcgctgtacttcacccgggggctcaagctgacggggacctacagc
atcatgatccagaagatcctcttcaaagaccttttccgcttcctcctggtctacttgctc
ttcatgatcggctatgcgtcagctctggtgtccctcctcaacccgtgtcccagcagtgag
tcctgcagcgaggagcagtccaactgcacggtgcccacctacccctcctgccgggacagc
cagaccttcagcaccttcctgctcgacctcttcaagctcaccatcggcatgggtgacttg
gagatgctcgagagcgccaagtaccccggcgtcttcatcatcctcctcgtcacctacatc
atcctcacctttgtgcttcttctcaacatgctcatcgctctcatgggtgagaccgtgggc
caagtctccaaggagagcaagcacatctggaagctgcagtgggccaccaccatcctggac
atcgagcgctccttccctgtgttcctgcggagagccttccgctcaggggagatggtcact
gtggggaagggcaccgatgggacgcccgaccgccgctggtgcttcagggtggacgaggtg
aactggtcccactggaaccagaatctgggcatcatcagcgaggatccaggcaagaatgac
acgtaccagtactacggcttctcccacaccatgggccggctgcggagagatcgctggtcg
acagtggtgccgcgtgtggtggagctcaacaagagctgccagccggatgaggtggtggtg
ccgctggggaccgtggggacagcggaggcacgggagcggcggcacggccaggcctcaagc
tccccgctctag

DBGET integrated database retrieval system