KEGG   Nipponia nippon (crested ibis): 104019353Help
Entry
104019353         CDS       T05756                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni00010  Glycolysis / Gluconeogenesis
nni00053  Ascorbate and aldarate metabolism
nni00071  Fatty acid degradation
nni00280  Valine, leucine and isoleucine degradation
nni00310  Lysine degradation
nni00330  Arginine and proline metabolism
nni00340  Histidine metabolism
nni00380  Tryptophan metabolism
nni00410  beta-Alanine metabolism
nni00561  Glycerolipid metabolism
nni00620  Pyruvate metabolism
nni01100  Metabolic pathways
Module
nni_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:nni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104019353 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    104019353 (ALDH2)
   00620 Pyruvate metabolism
    104019353 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104019353 (ALDH2)
   00561 Glycerolipid metabolism
    104019353 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104019353 (ALDH2)
   00310 Lysine degradation
    104019353 (ALDH2)
   00330 Arginine and proline metabolism
    104019353 (ALDH2)
   00340 Histidine metabolism
    104019353 (ALDH2)
   00380 Tryptophan metabolism
    104019353 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104019353 (ALDH2)
Enzymes [BR:nni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104019353 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 104019353
NCBI-ProteinID: XP_009470881
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MPAGTAGVEVRHTEIFINNEWHDAVSKKTFPTINPATGEVICQVAEGDKADVDKAVKAAK
AAFQLGSPWRRMDASHRGKLLNRLADLIERDRAYLAALETLDNGKPYSISYLVDLDMVVK
CLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGN
VVVMKVAEQTPLSALYVANLIKEAGFPPGVVNIIPGYGPTAGAAISSHMEVDKVAFTGST
EVGHLIQKAAAESNLKRVTLELGGKSPNIIMSDADMDWAVDQAHFALFFNQGQCCCAGSR
TYVQEDIYHEFVERSVEKAKSRVVGNPFDFKTEQGPQVDEEQFKKILGYISTGKREGAKL
LCGGNPAADRGYFIQPTVFGDVQDNMTIAREEIFGPVMQILKFKTIEEVIERANDSKYGL
AAAVFTKDLDKANYVSQGLRAGTVWINCYDVFGAQAPFGGYKASGNGRELGEYGLEAYVE
VKNVTIKIPQKNS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccagctggcacggcaggggtggaggttcggcacactgaaattttcataaataatgaa
tggcacgatgcagtcagtaagaaaaccttccccactatcaatccagccacaggagaagtt
atctgccaagttgctgagggcgataaggcagatgtggacaaggccgttaaggcggccaag
gcagctttccagctgggctcgccttggaggaggatggatgcttctcatcgggggaagctg
ctgaatcgtcttgctgacctgatcgagagggaccgggcttacctggcggcgctggagact
ctggataatggcaaaccgtactccatctcctacctggtggatttggacatggtagtcaaa
tgtctcagatactttgcaggttggtcggataaattccatggcaaaactatcccattggat
ggagacttcttctgttacacaagacatgagccggtgggagtttgtggacagataatcccg
tggaacttcccgctgttgatgcaggcatggaaacttgggcctgccctggctactgggaat
gtggttgtgatgaaagtggcagagcaaacccccctgagtgctctctacgtagctaatctg
atcaaagaggctggattcccaccaggcgtggtgaacatcatccccggctatgggcccacg
gcaggggctgccatctcttcccacatggaggtagacaaagtggccttcaccggctccacg
gaggttgggcatctgatccagaaggctgcagcagagagtaacctaaagagggtgacactg
gagcttggaggaaagagtccaaacataatcatgtctgatgcagacatggactgggctgtg
gatcaagcccattttgccctcttcttcaaccaagggcagtgctgctgtgctggatctcga
acctacgtccaggaagatatatatcatgagtttgtggagaggagtgttgagaaggccaag
tccagggtggttggaaacccgtttgactttaaaactgaacaggggcctcaggtagatgaa
gagcagtttaagaagattctcggttacattagtactgggaagcgtgaaggagccaaactg
ctgtgcggtggcaaccctgctgcggacagaggctattttatccagccaactgtctttggc
gacgtgcaggacaacatgacgattgccagagaggagatatttgggccggtcatgcagatt
ctgaaattcaaaacaattgaggaggtcattgagagagcaaatgactccaagtacggccta
gcagcagcagtctttacaaaggatcttgacaaagcaaactatgtgtcacagggcctgcga
gcgggaacagtttggataaactgctatgatgtgtttggtgcacaagccccgtttggcggc
tacaaagcttctgggaatgggcgagagctgggagaatacggtctggaggcatatgtagag
gtgaaaaatgtgacaatcaaaattccacagaaaaactcctaa

DBGET integrated database retrieval system