KEGG   Nipponia nippon (crested ibis): 104019653
Entry
104019653         CDS       T05756                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04060  Cytokine-cytokine receptor interaction
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04218  Cellular senescence
nni04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104019653 (TGFB2)
   04350 TGF-beta signaling pathway
    104019653 (TGFB2)
   04068 FoxO signaling pathway
    104019653 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104019653 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104019653 (TGFB2)
   04218 Cellular senescence
    104019653 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104019653 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:nni00536]
    104019653 (TGFB2)
Cytokines and growth factors [BR:nni04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104019653 (TGFB2)
Glycosaminoglycan binding proteins [BR:nni00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104019653 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 104019653
NCBI-ProteinID: XP_009471214
UniProt: A0A091VTS1
LinkDB
Position
Unknown
AA seq 412 aa
MHCYLLSVFLTVDLATVAFSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPENAIPPS
YYSLYFRIIRFDVSAMEKNASNLVKAEFRVFRLQNSKARVSEQRIELYQVLKSKELSSPG
QRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDYTYSSGDVKALKSNRKKYSGKTPHLLLMLLPSYRLESQQPSRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgtttctcaccgtggatctggccaccgtggctttcagc
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggcgatc
cgggggcagatcttgagcaaactgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaagag
aaagccaaccacagagccgccacttgcgaaagggagaggagcgacgaggagtattatgcc
aaagaagtttacaaaatagacatgcagcctttttaccctgaaaatgccatcccaccgagc
tattacagcctttacttccgaatcatcagatttgatgtctcagcgatggagaagaatgct
tccaacttggtgaaagctgagttcagggtcttccgcctgcagaactcaaaggcgcgggtc
tcggagcagcggatagagctgtatcaggttctaaaatctaaagaattatcatcaccagga
cagcgctacattgacagcaaagtagttaaaacaagagctgaaggagaatggttgtctttt
gatgtcactgaggctgtacacgagtggctccatcacagagacaggaaccttggatttaag
ataagcttacattgtccgtgctgcaccttcgtgccttccaataattacatcatcccaaat
aaaagtgaggagcttgaagcaagatttgcaggtattgatgactacacatattccagtggt
gatgtgaaagctttaaagtccaataggaaaaaatacagtgggaagaccccacatcttctg
ctaatgttattaccctcctacagacttgagtcgcaacagcccagtcggcggaagaagcgt
gctctagatgctgcctattgttttaggaatgtgcaggataattgctgtctgcgtccactt
tatattgacttcaagagggatcttggctggaaatggattcatgaacctaaaggatatcat
gctaatttctgtgcaggagcctgcccatatttgtggagctcagatactcagcacagcaga
gtactcagcttgtataacaccataaatccagaagcttctgcctctccatgctgcgtgtcc
caggatttggagcccctcaccatcctctactacattggcaaaacacccaaaattgaacag
ctgtccaacatgatcgtaaagtcttgcaagtgcagctaa

KEGG   Nipponia nippon (crested ibis): 104020998
Entry
104020998         CDS       T05756                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04010  MAPK signaling pathway
nni04060  Cytokine-cytokine receptor interaction
nni04068  FoxO signaling pathway
nni04110  Cell cycle
nni04218  Cellular senescence
nni04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104020998 (TGFB3)
   04350 TGF-beta signaling pathway
    104020998 (TGFB3)
   04068 FoxO signaling pathway
    104020998 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104020998 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104020998 (TGFB3)
   04218 Cellular senescence
    104020998 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nni04052]
    104020998 (TGFB3)
Cytokines and growth factors [BR:nni04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104020998 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 104020998
NCBI-ProteinID: XP_009472758
LinkDB
Position
Unknown
AA seq 412 aa
MKMYVQRALVLLSLLSFATVSLSLSSCTTLDLDHIKKKRVEAIRGQILSKLRLTSPPETV
GPAHVPYQILALYNSTRELLEEMEEEKEESCSQDNTESEYYAKEIHKFDMIQGLPEHNEL
GICPKGVTSNVFRFNVSSAEKNSTNLFRAEFRVLRVPNLSSKRSEQRIELFQILQPDEHI
AKQRYLSGRNVQTRGSPEWLSFDVTETVREWLLHRESNLGLEISIHCPCHTFQPNGDILE
NLHEVLEIKFKGIDSEDDYGRGDLGRLKKQKDLHNPHLILMMLPPHRLESPALGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgtacgtgcaaagggctctggtgctgctctccctgctgagcttcgccaccgtg
agcctctcgctgtcctcctgcaccaccttggacctggaccacatcaagaagaagagggtg
gaagccatccgggggcagatcctgagcaagctgcggctcaccagccccccggagaccgtg
gggccggcccatgtgccctaccagatcctggccctctataacagcacccgggagctgctg
gaggagatggaggaggagaaggaggagagctgctctcaggacaacaccgagtccgaatac
tatgccaaagagatccataaatttgacatgatccagggcctccccgagcacaatgagttg
ggcatttgtccaaaaggtgtcacctccaacgtgttccgctttaatgtgtcctcggcagag
aagaacagtaccaacttattccgggccgagtttcgggtgctgcgtgtgcccaacctgagc
tccaaacgcagcgagcagcgcattgagcttttccagatccttcagccggatgagcacata
gcaaagcagcgctacctcagtggcaggaatgtgcagacacggggctcccctgagtggctg
tccttcgatgtcaccgagactgtgcgtgagtggcttctgcacagagagtccaaccttggc
ctggaaattagtatacactgtccttgccatacttttcagcccaacggagacatcttggag
aatttgcacgaggtcttggagatcaagttcaaaggcattgacagtgaggatgactacggc
cgtggggacttggggcgcctgaagaagcagaaggacttgcataatccccacctcatcttg
atgatgttacccccacatcggctggagagcccagcgttgggaggccaaagaaagaaacgg
gccctggataccaactactgtttccggaacctggaggagaactgctgtgtgcgtcctctg
tacatcgacttccgacaggacctgggctggaaatgggtccatgagcctaagggctacttt
gctaacttttgttcggggccttgtccatacctccgcagcgcagacaccactcacagcacg
gtgctgggcttatacaacacgctgaaccctgaggcatccgcttcgccctgctgtgtcccc
caggacctggagccactcactatcttgtactatgtcgggaggacccccaaagtggagcag
ctctccaacatggtggtgaaatcctgcaagtgcagctga

DBGET integrated database retrieval system